Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

14-3-3-like protein GF14 lambda

Gene

GRF6

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes (By similarity). Specific negative regulator of slow-vacuolar (SV) ion channel. Mediates F-actin dynamics possibly through inhibiting ADF1 phosphorylation (PubMed:26345162). Negative regulator of freezing tolerance that modulates cold-responsive C-repeat-binding factors (CBF) DREB1A AND DREB1B proteins stability by facilitating their ubiquitin-mediated degradation when activated by CRPK1-mediated phosophorylation in freezing conditions (PubMed:28344081).By similarity3 Publications

GO - Molecular functioni

GO - Biological processi

  • brassinosteroid mediated signaling pathway Source: TAIR
  • defense response to bacterium Source: TAIR
  • response to cadmium ion Source: TAIR
  • response to freezing Source: UniProtKB

Keywordsi

Biological processStress response

Enzyme and pathway databases

ReactomeiR-ATH-1445148. Translocation of GLUT4 to the plasma membrane.
R-ATH-3371453. Regulation of HSF1-mediated heat shock response.
R-ATH-3371511. HSF1 activation.

Names & Taxonomyi

Protein namesi
Recommended name:
14-3-3-like protein GF14 lambda
Alternative name(s):
14-3-3-like protein AFT1
14-3-3-like protein RCI2
General regulatory factor 6
Gene namesi
Name:GRF6
Synonyms:AFT1, RCI2
Ordered Locus Names:At5g10450
ORF Names:F12B17_200
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 5

Organism-specific databases

AraportiAT5G10450.
TAIRilocus:2142489. AT5G10450.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Disruption phenotypei

Increased length of hypocotyls under dark-grown conditions. Altered actin arrays in hypocotyl cells. Enhanced freezing tolerance associated with enhanced cold induction of cold-responsive C-repeat-binding factor (CBF) target genes in the double mutant lacking both GRF6 and GRF8, probably due to the suppression of ubiquitin-mediated degradation DREB1A and DREB1B degradation by the 26S proteasome pathway (PubMed:28344081).2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi61S → A: Normal phosphorylation. 1 Publication1
Mutagenesisi70S → A: Reduced phosphorylation by CRPK1. Impaired phosphorylation and loss of translocation from cytoplasm to the nucleus in response to cold; when associated with A-112; A-193 and A-214. 1 Publication1
Mutagenesisi112S → A: Reduced phosphorylation by CRPK1. Impaired phosphorylation and loss of translocation from cytoplasm to the nucleus in response to cold; when associated with A-70; A-193 and A-214. 1 Publication1
Mutagenesisi193S → A: Reduced phosphorylation by CRPK1. Impaired phosphorylation and loss of translocation from cytoplasm to the nucleus in response to cold; when associated with A-70; A-112 and A-214. 1 Publication1
Mutagenesisi214T → A: Reduced phosphorylation by CRPK1. Impaired phosphorylation and loss of translocation from cytoplasm to the nucleus in response to cold; when associated with A-70; A-112 and A-193. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000586681 – 24814-3-3-like protein GF14 lambdaAdd BLAST248

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei70Phosphoserine; by CRPK11 Publication1
Modified residuei112Phosphoserine; by CRPK11 Publication1
Modified residuei193Phosphoserine; by CRPK11 Publication1
Modified residuei214Phosphothreonine; by CRPK11 Publication1

Post-translational modificationi

Transphosphorylated by SERK1.
Phosphorylated by CRPK1 in response to cold.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP48349.
PRIDEiP48349.

PTM databases

iPTMnetiP48349.
SwissPalmiP48349.

Expressioni

Inductioni

By cold.

Gene expression databases

ExpressionAtlasiP48349. baseline and differential.
GenevisibleiP48349. AT.

Interactioni

Subunit structurei

Interacts with SERK1 in the cell membrane. Component of the SERK1 signaling complex, composed of KAPP, CDC48A, GRF6 or GRF7, SERK1, SERK2, SERK3/BAK1 and BRI1 (PubMed:15592873). Interacts with TPK1 (PubMed:17764516). Interacts with ADF1 (PubMed:26345162). Binds to CRPK1 at the plasma membrane. Interacts with DREB1A and DREB1B in the nucleus when activated by CRPK1-mediated phosophorylation upon freezing (PubMed:28344081).4 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi16187. 26 interactors.
IntActiP48349. 13 interactors.
MINTiMINT-7147002.
STRINGi3702.AT5G10450.4.

Structurei

3D structure databases

ProteinModelPortaliP48349.
SMRiP48349.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the 14-3-3 family.Curated

Phylogenomic databases

eggNOGiKOG0841. Eukaryota.
COG5040. LUCA.
HOGENOMiHOG000240379.
InParanoidiP48349.
OMAiIKNCGET.
PhylomeDBiP48349.

Family and domain databases

Gene3Di1.20.190.20. 1 hit.
InterProiView protein in InterPro
IPR000308. 14-3-3.
IPR023409. 14-3-3_CS.
IPR036815. 14-3-3_dom_sf.
IPR023410. 14-3-3_domain.
PANTHERiPTHR18860. PTHR18860. 1 hit.
PfamiView protein in Pfam
PF00244. 14-3-3. 1 hit.
PIRSFiPIRSF000868. 14-3-3. 1 hit.
PRINTSiPR00305. 1433ZETA.
SMARTiView protein in SMART
SM00101. 14_3_3. 1 hit.
SUPFAMiSSF48445. SSF48445. 1 hit.
PROSITEiView protein in PROSITE
PS00796. 1433_1. 1 hit.
PS00797. 1433_2. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P48349-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAATLGRDQY VYMAKLAEQA ERYEEMVQFM EQLVTGATPA EELTVEERNL
60 70 80 90 100
LSVAYKNVIG SLRAAWRIVS SIEQKEESRK NDEHVSLVKD YRSKVESELS
110 120 130 140 150
SVCSGILKLL DSHLIPSAGA SESKVFYLKM KGDYHRYMAE FKSGDERKTA
160 170 180 190 200
AEDTMLAYKA AQDIAAADMA PTHPIRLGLA LNFSVFYYEI LNSSDKACNM
210 220 230 240
AKQAFEEAIA ELDTLGEESY KDSTLIMQLL RDNLTLWTSD MQEQMDEA
Length:248
Mass (Da):27,976
Last modified:February 1, 1996 - v1
Checksum:i4017D23098E74891
GO
Isoform 2 (identifier: P48349-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     243-248: EQMDEA → TNQMHHIRDIKEHVKTEITAKPCVLSYYYSM

Show »
Length:273
Mass (Da):30,991
Checksum:i10723A99DD393E46
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti241 – 248MQEQMDEA → YAGADGRGLRI in CAA52238 (PubMed:7520301).Curated8

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041594243 – 248EQMDEA → TNQMHHIRDIKEHVKTEITA KPCVLSYYYSM in isoform 2. Curated6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74141 mRNA. Translation: CAA52238.1.
U02565 mRNA. Translation: AAA74737.1.
U68545 mRNA. Translation: AAB08482.1.
AF145298 Genomic DNA. Translation: AAD51781.1.
AL353995 Genomic DNA. Translation: CAB89398.1.
CP002688 Genomic DNA. Translation: AED91541.1.
CP002688 Genomic DNA. Translation: AED91544.1.
AY052293 mRNA. Translation: AAK96486.1.
AY061918 mRNA. Translation: AAL31245.1.
PIRiS47970.
S53727.
T49994.
RefSeqiNP_001190276.1. NM_001203347.1. [P48349-2]
NP_568229.1. NM_121083.4. [P48349-1]
UniGeneiAt.24269.

Genome annotation databases

EnsemblPlantsiAT5G10450.1; AT5G10450.1; AT5G10450. [P48349-1]
AT5G10450.4; AT5G10450.4; AT5G10450. [P48349-2]
GeneIDi830909.
GrameneiAT5G10450.1; AT5G10450.1; AT5G10450.
AT5G10450.4; AT5G10450.4; AT5G10450.
KEGGiath:AT5G10450.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry namei14336_ARATH
AccessioniPrimary (citable) accession number: P48349
Secondary accession number(s): P42647, Q9LX97
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: February 1, 1996
Last modified: October 25, 2017
This is version 146 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families