Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

14-3-3-like protein GF14 lambda

Gene

GRF6

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes (By similarity). Specific negative regulator of slow-vacuolar (SV) ion channel. Mediates F-actin dynamics possibly through inhibiting ADF1 phosphorylation (PubMed:26345162).By similarity2 Publications

Keywords - Biological processi

Stress response

Enzyme and pathway databases

ReactomeiR-ATH-3371453. Regulation of HSF1-mediated heat shock response.
R-ATH-3371511. HSF1 activation.

Names & Taxonomyi

Protein namesi
Recommended name:
14-3-3-like protein GF14 lambda
Alternative name(s):
14-3-3-like protein AFT1
14-3-3-like protein RCI2
General regulatory factor 6
Gene namesi
Name:GRF6
Synonyms:AFT1, RCI2
Ordered Locus Names:At5g10450
ORF Names:F12B17_200
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 5

Organism-specific databases

TAIRiAT5G10450.

Subcellular locationi

  • Nucleus 1 Publication
  • Cell membrane 1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Nucleus

Pathology & Biotechi

Disruption phenotypei

Increased length of hypocotyls under dark-grown conditions. Altered actin arrays in hypocotyl cells.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 24824814-3-3-like protein GF14 lambdaPRO_0000058668Add
BLAST

Post-translational modificationi

Transphosphorylated by SERK1.

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP48349.
PRIDEiP48349.

PTM databases

iPTMnetiP48349.
SwissPalmiP48349.

Expressioni

Inductioni

By cold.

Gene expression databases

ExpressionAtlasiP48349. baseline and differential.
GenevisibleiP48349. AT.

Interactioni

Subunit structurei

Interacts with SERK1 in the cell membrane. Component of the SERK1 signaling complex, composed of KAPP, CDC48A, GRF6 or GRF7, SERK1, SERK2, SERK3/BAK1 and BRI1 (PubMed:15592873). Interacts with TPK1 (PubMed:17764516). Interacts with ADF1 (PubMed:26345162).3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BZR1Q8S3075EBI-1633785,EBI-1803261
PHOT1O489636EBI-1633785,EBI-1553849
RPW8.2Q9C5Z64EBI-1633785,EBI-2460628
SERK1Q94AG26EBI-1633785,EBI-1555537

Protein-protein interaction databases

BioGridi16187. 22 interactions.
IntActiP48349. 13 interactions.
MINTiMINT-7147002.
STRINGi3702.AT5G10450.4.

Structurei

3D structure databases

ProteinModelPortaliP48349.
SMRiP48349. Positions 7-240.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the 14-3-3 family.Curated

Phylogenomic databases

eggNOGiKOG0841. Eukaryota.
COG5040. LUCA.
HOGENOMiHOG000240379.
InParanoidiP48349.
OMAiELSDICA.
PhylomeDBiP48349.

Family and domain databases

InterProiIPR000308. 14-3-3.
IPR023409. 14-3-3_CS.
IPR023410. 14-3-3_domain.
[Graphical view]
PANTHERiPTHR18860. PTHR18860. 1 hit.
PfamiPF00244. 14-3-3. 1 hit.
[Graphical view]
PIRSFiPIRSF000868. 14-3-3. 1 hit.
PRINTSiPR00305. 1433ZETA.
SMARTiSM00101. 14_3_3. 1 hit.
[Graphical view]
SUPFAMiSSF48445. SSF48445. 1 hit.
PROSITEiPS00796. 1433_1. 1 hit.
PS00797. 1433_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P48349-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAATLGRDQY VYMAKLAEQA ERYEEMVQFM EQLVTGATPA EELTVEERNL
60 70 80 90 100
LSVAYKNVIG SLRAAWRIVS SIEQKEESRK NDEHVSLVKD YRSKVESELS
110 120 130 140 150
SVCSGILKLL DSHLIPSAGA SESKVFYLKM KGDYHRYMAE FKSGDERKTA
160 170 180 190 200
AEDTMLAYKA AQDIAAADMA PTHPIRLGLA LNFSVFYYEI LNSSDKACNM
210 220 230 240
AKQAFEEAIA ELDTLGEESY KDSTLIMQLL RDNLTLWTSD MQEQMDEA
Length:248
Mass (Da):27,976
Last modified:February 1, 1996 - v1
Checksum:i4017D23098E74891
GO
Isoform 2 (identifier: P48349-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     243-248: EQMDEA → TNQMHHIRDIKEHVKTEITAKPCVLSYYYSM

Show »
Length:273
Mass (Da):30,991
Checksum:i10723A99DD393E46
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti241 – 2488MQEQMDEA → YAGADGRGLRI in CAA52238 (PubMed:7520301).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei243 – 2486EQMDEA → TNQMHHIRDIKEHVKTEITA KPCVLSYYYSM in isoform 2. CuratedVSP_041594

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74141 mRNA. Translation: CAA52238.1.
U02565 mRNA. Translation: AAA74737.1.
U68545 mRNA. Translation: AAB08482.1.
AF145298 Genomic DNA. Translation: AAD51781.1.
AL353995 Genomic DNA. Translation: CAB89398.1.
CP002688 Genomic DNA. Translation: AED91541.1.
CP002688 Genomic DNA. Translation: AED91544.1.
AY052293 mRNA. Translation: AAK96486.1.
AY061918 mRNA. Translation: AAL31245.1.
PIRiS47970.
S53727.
T49994.
RefSeqiNP_001190276.1. NM_001203347.1. [P48349-2]
NP_568229.1. NM_121083.3. [P48349-1]
UniGeneiAt.24269.

Genome annotation databases

EnsemblPlantsiAT5G10450.1; AT5G10450.1; AT5G10450. [P48349-1]
GeneIDi830909.
KEGGiath:AT5G10450.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74141 mRNA. Translation: CAA52238.1.
U02565 mRNA. Translation: AAA74737.1.
U68545 mRNA. Translation: AAB08482.1.
AF145298 Genomic DNA. Translation: AAD51781.1.
AL353995 Genomic DNA. Translation: CAB89398.1.
CP002688 Genomic DNA. Translation: AED91541.1.
CP002688 Genomic DNA. Translation: AED91544.1.
AY052293 mRNA. Translation: AAK96486.1.
AY061918 mRNA. Translation: AAL31245.1.
PIRiS47970.
S53727.
T49994.
RefSeqiNP_001190276.1. NM_001203347.1. [P48349-2]
NP_568229.1. NM_121083.3. [P48349-1]
UniGeneiAt.24269.

3D structure databases

ProteinModelPortaliP48349.
SMRiP48349. Positions 7-240.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi16187. 22 interactions.
IntActiP48349. 13 interactions.
MINTiMINT-7147002.
STRINGi3702.AT5G10450.4.

PTM databases

iPTMnetiP48349.
SwissPalmiP48349.

Proteomic databases

PaxDbiP48349.
PRIDEiP48349.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT5G10450.1; AT5G10450.1; AT5G10450. [P48349-1]
GeneIDi830909.
KEGGiath:AT5G10450.

Organism-specific databases

TAIRiAT5G10450.

Phylogenomic databases

eggNOGiKOG0841. Eukaryota.
COG5040. LUCA.
HOGENOMiHOG000240379.
InParanoidiP48349.
OMAiELSDICA.
PhylomeDBiP48349.

Enzyme and pathway databases

ReactomeiR-ATH-3371453. Regulation of HSF1-mediated heat shock response.
R-ATH-3371511. HSF1 activation.

Miscellaneous databases

PROiP48349.

Gene expression databases

ExpressionAtlasiP48349. baseline and differential.
GenevisibleiP48349. AT.

Family and domain databases

InterProiIPR000308. 14-3-3.
IPR023409. 14-3-3_CS.
IPR023410. 14-3-3_domain.
[Graphical view]
PANTHERiPTHR18860. PTHR18860. 1 hit.
PfamiPF00244. 14-3-3. 1 hit.
[Graphical view]
PIRSFiPIRSF000868. 14-3-3. 1 hit.
PRINTSiPR00305. 1433ZETA.
SMARTiSM00101. 14_3_3. 1 hit.
[Graphical view]
SUPFAMiSSF48445. SSF48445. 1 hit.
PROSITEiPS00796. 1433_1. 1 hit.
PS00797. 1433_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Two related low-temperature-inducible genes of Arabidopsis encode proteins showing high homology to 14-3-3 proteins, a family of putative kinase regulators."
    Jarillo J.A., Capel J., Leyva A., Martinez Zapater J.M., Salinas J.
    Plant Mol. Biol. 25:693-704(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
  2. "Isolation and expression of an Arabidopsis 14-3-3-like protein gene."
    Zhang H., Wang J., Hwang I., Goodman H.M.
    Biochim. Biophys. Acta 1266:113-116(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Strain: cv. Columbia.
    Tissue: Leaf.
  3. Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Strain: cv. Columbia.
  4. "Sequences of five Arabidopsis general regulatory factor (GRF) genes encoding 14-3-3 proteins."
    Chung H.-J., Shanker S., Ferl R.J.
    Plant Gene Register PGR99-114
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Strain: cv. Columbia.
  5. "Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana."
    Tabata S., Kaneko T., Nakamura Y., Kotani H., Kato T., Asamizu E., Miyajima N., Sasamoto S., Kimura T., Hosouchi T., Kawashima K., Kohara M., Matsumoto M., Matsuno A., Muraki A., Nakayama S., Nakazaki N., Naruo K.
    , Okumura S., Shinpo S., Takeuchi C., Wada T., Watanabe A., Yamada M., Yasuda M., Sato S., de la Bastide M., Huang E., Spiegel L., Gnoj L., O'Shaughnessy A., Preston R., Habermann K., Murray J., Johnson D., Rohlfing T., Nelson J., Stoneking T., Pepin K., Spieth J., Sekhon M., Armstrong J., Becker M., Belter E., Cordum H., Cordes M., Courtney L., Courtney W., Dante M., Du H., Edwards J., Fryman J., Haakensen B., Lamar E., Latreille P., Leonard S., Meyer R., Mulvaney E., Ozersky P., Riley A., Strowmatt C., Wagner-McPherson C., Wollam A., Yoakum M., Bell M., Dedhia N., Parnell L., Shah R., Rodriguez M., Hoon See L., Vil D., Baker J., Kirchoff K., Toth K., King L., Bahret A., Miller B., Marra M.A., Martienssen R., McCombie W.R., Wilson R.K., Murphy G., Bancroft I., Volckaert G., Wambutt R., Duesterhoeft A., Stiekema W., Pohl T., Entian K.-D., Terryn N., Hartley N., Bent E., Johnson S., Langham S.-A., McCullagh B., Robben J., Grymonprez B., Zimmermann W., Ramsperger U., Wedler H., Balke K., Wedler E., Peters S., van Staveren M., Dirkse W., Mooijman P., Klein Lankhorst R., Weitzenegger T., Bothe G., Rose M., Hauf J., Berneiser S., Hempel S., Feldpausch M., Lamberth S., Villarroel R., Gielen J., Ardiles W., Bents O., Lemcke K., Kolesov G., Mayer K.F.X., Rudd S., Schoof H., Schueller C., Zaccaria P., Mewes H.-W., Bevan M., Fransz P.F.
    Nature 408:823-826(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  6. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  7. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
    Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
    , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
    Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Strain: cv. Columbia.
  8. "The Arabidopsis SERK1 protein interacts with the AAA-ATPase AtCDC48, the 14-3-3 protein GF14lambda and the PP2C phosphatase KAPP."
    Rienties I.M., Vink J., Borst J.W., Russinova E., de Vries S.C.
    Planta 221:394-405(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SERK1, PHOSPHORYLATION, SUBCELLULAR LOCATION, IDENTIFICATION IN THE SERK1 COMPLEX.
  9. "TPK1, a Ca(2+)-regulated Arabidopsis vacuole two-pore K(+) channel is activated by 14-3-3 proteins."
    Latz A., Becker D., Hekman M., Mueller T., Beyhl D., Marten I., Eing C., Fischer A., Dunkel M., Bertl A., Rapp U.R., Hedrich R.
    Plant J. 52:449-459(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH TPK1.
  10. "14-3-3 lambda protein interacts with ADF1 to regulate actin cytoskeleton dynamics in Arabidopsis."
    Zhao S., Zhao Y., Guo Y.
    Sci. China Life Sci. 58:1142-1150(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH ADF1, DISRUPTION PHENOTYPE.

Entry informationi

Entry namei14336_ARATH
AccessioniPrimary (citable) accession number: P48349
Secondary accession number(s): P42647, Q9LX97
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: February 1, 1996
Last modified: June 8, 2016
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.