P48059 (LIMS1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 137.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LIM and senescent cell antigen-like-containing domain protein 1 Alternative name(s): Particularly interesting new Cys-His protein 1 Short name=PINCH-1 Renal carcinoma antigen NY-REN-48 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 325 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Adapter protein in a cytoplasmic complex linking beta-integrins to the actin cytoskeleton, bridges the complex to cell surface receptor tyrosine kinases and growth factor receptors. Involved in the regulation of cell survival, cell proliferation and cell differentiation. |
| Subunit structure | Interacts (via LIM zinc-binding 5) with TGFB1I1 By similarity. Interacts with integrin-linked protein kinase 1 (ILK) via the first LIM domain, and in competition with LIMS2. Part of the heterotrimeric IPP complex composed of integrin-linked kinase (ILK), LIMS1 or LIMS2, and PARVA. Interacts with SH3/SH2 adapter NCK2, thereby linking the complex to cell surface receptors. Ref.7 Ref.9 |
| Subcellular location | Cell junction › focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side Ref.9 Ref.15. |
| Tissue specificity | Expressed in most tissues except in the brain. |
| Sequence similarities | Contains 5 LIM zinc-binding domains. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Hoxa1 | P09022 | 3 | EBI-306928,EBI-3957603 | From a different organism. |
| ILK | Q13418 | 3 | EBI-306928,EBI-747644 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P48059-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P48059-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLGVAAGMTHSNM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P48059-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVYKEFCDFYAKFNM | ||||||
| Isoform 4 (identifier: P48059-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MTCNM | ||||||
| Isoform 5 (identifier: P48059-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELSNM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 325 | 324 | LIM and senescent cell antigen-like-containing domain protein 1 | PRO_0000075888 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 10 – 62 | 53 | LIM zinc-binding 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 71 – 121 | 51 | LIM zinc-binding 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 135 – 184 | 50 | LIM zinc-binding 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 193 – 243 | 51 | LIM zinc-binding 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 252 – 303 | 52 | LIM zinc-binding 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MLGVAAGMTHSNM in isoform 2. | VSP_042672 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MAFSGRARPCIIPENEEIPR AALNTVHEANGTEDERAVSK LQRRHSDVKVYKEFCDFYAK FNM in isoform 3. | VSP_043210 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MTCNM in isoform 4. | VSP_043211 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MTALQLKELSHSGLYRRRRD RPDSLRVNGLPEEELSNM in isoform 5. | VSP_043212 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 42 | 1 | F → A: Loss of interaction with ILK and loss of localization to focal adhesion. Ref.14 Ref.15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 56 | 1 | R → A: Alters interaction with ILK. Ref.15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 61 | 1 | H → D: Alters interaction with ILK. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 62 | 1 | D → A: Alters interaction with ILK. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 66 | 1 | L → D: Alters interaction with ILK. Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 78 | 1 | I → T in AAH05341. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 262 | 1 | D → G in AAH05341. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 11 – 13 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 22 – 26 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 29 – 32 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 33 – 35 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 39 – 41 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 46 – 48 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 51 – 53 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 56 – 58 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 60 – 66 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 72 – 74 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 83 – 85 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 88 – 90 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 92 – 94 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 98 – 100 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 105 – 107 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 110 – 112 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 115 – 117 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 119 – 126 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 136 – 138 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 150 – 152 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 156 – 158 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 162 – 164 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 173 – 175 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 178 – 180 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 182 – 186 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 194 – 197 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 210 – 213 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 214 – 216 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 220 – 222 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 227 – 229 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 232 – 234 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 237 – 239 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 241 – 247 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A new LIM protein containing an autoepitope homologous to 'senescent cell antigen'." Rearden A. Biochem. Biophys. Res. Commun. 201:1124-1131(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Fetal liver. |
| [2] | Rearden A. Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION TO C-TERMINUS. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 5). Tissue: Testis, Tongue and Trachea. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone marrow. |
| [6] | "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-12, ACETYLATION AT ALA-2. Tissue: Platelet. |
| [7] | "Nck-2, a novel Src homology2/3-containing adaptor protein that interacts with the LIM-only protein PINCH and components of growth factor receptor kinase-signaling pathways." Tu Y., Li F., Wu C. Mol. Biol. Cell 9:3367-3382(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NCK2. |
| [8] | "Antigens recognized by autologous antibody in patients with renal-cell carcinoma." Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J. Int. J. Cancer 83:456-464(1999) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION AS A RENAL CANCER ANTIGEN. Tissue: Renal cell carcinoma. |
| [9] | "The LIM-only protein PINCH directly interacts with integrin-linked kinase and is recruited to integrin-rich sites in spreading cells." Tu Y., Li F., Goicoechea S., Wu C. Mol. Cell. Biol. 19:2425-2434(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ILK AND NCK2, SUBCELLULAR LOCATION. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "Solution structure of the focal adhesion adaptor PINCH LIM1 domain and characterization of its interaction with the integrin-linked kinase ankyrin repeat domain." Velyvis A., Yang Y., Wu C., Qin J. J. Biol. Chem. 276:4932-4939(2001) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 1-70. |
| [12] | "Structural and functional insights into PINCH LIM4 domain-mediated integrin signaling." Velyvis A., Vaynberg J., Yang Y., Vinogradova O., Zhang Y., Wu C., Qin J. Nat. Struct. Biol. 10:558-564(2003) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 188-251. |
| [13] | "Solution structure of the second and third LIM domain of particularly interesting new Cys-His protein (PINCH)." RIKEN structural genomics initiative (RSGI) Submitted (JUN-2006) to the PDB data bank Cited for: STRUCTURE BY NMR OF 71-190. |
| [14] | "The structural basis of integrin-linked kinase-PINCH interactions." Chiswell B.P., Zhang R., Murphy J.W., Boggon T.J., Calderwood D.A. Proc. Natl. Acad. Sci. U.S.A. 105:20677-20682(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.6 ANGSTROMS) OF 6-68 IN COMPLEX WITH ILK, MUTAGENESIS OF PHE-42; HIS-61; ASP-62 AND LEU-66. |
| [15] | "Structural basis of focal adhesion localization of LIM-only adaptor PINCH by integrin-linked kinase." Yang Y., Wang X., Hawkins C.A., Chen K., Vaynberg J., Mao X., Tu Y., Zuo X., Wang J., Wang Y.-X., Wu C., Tjandra N., Qin J. J. Biol. Chem. 284:5836-5844(2009) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 1-70 IN COMPLEX WITH ILK, MUTAGENESIS OF PHE-42 AND ARG-56, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U09284 mRNA. Translation: AAA20086.2. AK296992 mRNA. Translation: BAH12469.1. AK302411 mRNA. Translation: BAH13699.1. AK304260 mRNA. Translation: BAH14143.1. AK314217 mRNA. Translation: BAG36891.1. AC010095 Genomic DNA. Translation: AAY14983.1. AC012487 Genomic DNA. No translation available. BC005341 mRNA. Translation: AAH05341.1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00788612. IPI00917739. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | JC2324. | ||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001180411.1. NM_001193482.1. NP_001180412.1. NM_001193483.2. NP_001180413.1. NM_001193484.1. NP_001180414.1. NM_001193485.2. NP_001180417.1. NM_001193488.1. NP_004978.2. NM_004987.5. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.597715. Hs.613268. | ||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P48059. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-40671N. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P48059. 24 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-5004275. | ||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000331775. | ||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P48059. | ||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 18266876. | ||||||||||||||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| OGP | P48059. | ||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P48059. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P48059. | ||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 3987. | ||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000332345; ENSP00000331775; ENSG00000169756. ENST00000338045; ENSP00000337598; ENSG00000169756. ENST00000393310; ENSP00000376987; ENSG00000169756. ENST00000409441; ENSP00000387264; ENSG00000169756. ENST00000410093; ENSP00000386926; ENSG00000169756. ENST00000542845; ENSP00000446121; ENSG00000169756. ENST00000544547; ENSP00000437912; ENSG00000169756. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 3987. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:3987. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002teg.3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 3987. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC02P109150. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:6616. LIMS1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 602567. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P48059. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA30389. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG263350. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000253950. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG000053. | ||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P48059. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | QNRALCH. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4NP73S. | ||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111155. Cell-Cell communication. | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P48059. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P48059. | ||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_LIMS1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P48059. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000169756. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 2.10.110.10. 5 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR017351. PINCH. IPR001781. Znf_LIM. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00412. LIM. 5 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF038003. PINCH. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00132. LIM. 5 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00478. LIM_DOMAIN_1. 4 hits. PS50023. LIM_DOMAIN_2. 5 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | LIMS1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P48059. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 3987. | ||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 15640. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | LIMS1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P48059 Secondary accession number(s): B2RAJ4 Q9BS44 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
