P48029 (SC6A8_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sodium- and chloride-dependent creatine transporter 1 Short name=CT1 Short name=Creatine transporter 1 Alternative name(s): Solute carrier family 6 member 8 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 635 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for the uptake of creatine in muscles and brain. |
| Subcellular location | |
| Tissue specificity | Predominantly expressed in skeletal muscle and kidney. Also found in brain, heart, colon, testis and prostate. Ref.1 Ref.2 |
| Involvement in disease | X-linked creatine deficiency syndrome (XL-CDS) [MIM:300352]: Causes developmental delay, hypotonia, mental retardation, seizures, short stature and midface hypoplasia. |
| Sequence similarities | Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A8 subfamily. [View classification] |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P48029-1) Also known as: CRT1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P48029-2) Also known as: CRT2; SLC6A8B; The sequence of this isoform differs from the canonical sequence as follows: 1-259: MAKKSAENGI...VWKGVKSTGK → MLPTLQIQGP...TASAEQPGPQ 417-417: S → SQVCMGLWDREPGGGRREGCRQGKGWRRCGDRPELPWP 464-464: D → DVSGVGGLPVTSGGRLPSSLTGLCPQ 498-498: Y → YGRSWLRAGLGDGGGEGRSPAWPSRLTSPQ | ||||||
| Isoform 3 (identifier: P48029-3) Also known as: SLC6A8C; The sequence of this isoform differs from the canonical sequence as follows: 1-365: Missing. | ||||||
| Isoform 4 (identifier: P48029-4) The sequence of this isoform differs from the canonical sequence as follows: 1-115: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 635 | 635 | Sodium- and chloride-dependent creatine transporter 1 | PRO_0000214774 | |||||
Regions | |||||||||
| Topological domain | 1 – 60 | 60 | Cytoplasmic Potential | ||||||
| Transmembrane | 61 – 81 | 21 | Helical; Potential | ||||||
| Topological domain | 82 – 87 | 6 | Extracellular Potential | ||||||
| Transmembrane | 88 – 108 | 21 | Helical; Potential | ||||||
| Topological domain | 109 – 138 | 30 | Cytoplasmic Potential | ||||||
| Transmembrane | 139 – 159 | 21 | Helical; Potential | ||||||
| Topological domain | 160 – 230 | 71 | Extracellular Potential | ||||||
| Transmembrane | 231 – 251 | 21 | Helical; Potential | ||||||
| Topological domain | 252 – 269 | 18 | Cytoplasmic Potential | ||||||
| Transmembrane | 270 – 290 | 21 | Helical; Potential | ||||||
| Topological domain | 291 – 304 | 14 | Extracellular Potential | ||||||
| Transmembrane | 305 – 325 | 21 | Helical; Potential | ||||||
| Topological domain | 326 – 341 | 16 | Cytoplasmic Potential | ||||||
| Transmembrane | 342 – 362 | 21 | Helical; Potential | ||||||
| Topological domain | 363 – 394 | 32 | Extracellular Potential | ||||||
| Transmembrane | 395 – 415 | 21 | Helical; Potential | ||||||
| Topological domain | 416 – 444 | 29 | Cytoplasmic Potential | ||||||
| Transmembrane | 445 – 465 | 21 | Helical; Potential | ||||||
| Topological domain | 466 – 479 | 14 | Extracellular Potential | ||||||
| Transmembrane | 480 – 500 | 21 | Helical; Potential | ||||||
| Topological domain | 501 – 520 | 20 | Cytoplasmic Potential | ||||||
| Transmembrane | 521 – 541 | 21 | Helical; Potential | ||||||
| Topological domain | 542 – 560 | 19 | Extracellular Potential | ||||||
| Transmembrane | 561 – 581 | 21 | Helical; Potential | ||||||
| Topological domain | 582 – 635 | 54 | Cytoplasmic Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 42 | 1 | Phosphothreonine Ref.11 | ||||||
| Glycosylation | 192 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 197 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 548 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 365 | 365 | Missing in isoform 3. | VSP_043916 | |||||
| Alternative sequence | 1 – 259 | 259 | MAKKS…KSTGK → MLPTLQIQGPAAFAPGDRGP GRHCPFPVPITPTGALLPVS DSCDSLVDLVWPSVTYLALG TQSRVWPHPLGAPGQAGESP EQRRQCLELWDMASSLGDKV PRAACGKRGQTVWQLHLACL CLAQFHSPPAQPPPLSRRGG GPDPDPISRSLPGPPTPALP THSYSSHSPRAPRLLSPLRR APRGSPAPHRHASLQTNEAP RELPHCTWPGLPGRSLAPSF LWREPWLGGQWGPLNIPARK GDRRRWEWGCEGGGATASAE QPGPQ in isoform 2. | VSP_043917 | |||||
| Alternative sequence | 1 – 115 | 115 | Missing in isoform 4. | VSP_046316 | |||||
| Alternative sequence | 417 | 1 | S → SQVCMGLWDREPGGGRREGC RQGKGWRRCGDRPELPWP in isoform 2. | VSP_043918 | |||||
| Alternative sequence | 464 | 1 | D → DVSGVGGLPVTSGGRLPSSL TGLCPQ in isoform 2. | VSP_043919 | |||||
| Alternative sequence | 498 | 1 | Y → YGRSWLRAGLGDGGGEGRSP AWPSRLTSPQ in isoform 2. | VSP_043920 | |||||
| Natural variant | 87 | 1 | G → R in XL-CDS. Ref.14 | VAR_020525 | |||||
| Natural variant | 132 | 1 | G → V in XL-CDS. Ref.15 | VAR_063707 | |||||
| Natural variant | 164 | 1 | T → S. Corresponds to variant rs642454 [ dbSNP | Ensembl ]. | VAR_034483 | |||||
| Natural variant | 337 | 1 | C → W in XL-CDS. Ref.14 | VAR_063708 | |||||
| Natural variant | 381 | 1 | G → R in XL-CDS. Ref.12 | VAR_020526 | |||||
| Natural variant | 390 | 1 | P → L in XL-CDS. Ref.14 | VAR_020527 | |||||
| Natural variant | 408 | 1 | Missing in XL-CDS. Ref.13 | VAR_020528 | |||||
| Natural variant | 491 | 1 | C → W in XL-CDS. Ref.15 | VAR_063709 | |||||
| Natural variant | 554 | 1 | P → L in XL-CDS. Ref.14 | VAR_020529 | |||||
| Natural variant | 560 | 1 | M → V. Ref.14 | VAR_063710 | |||||
Experimental info | |||||||||
| Sequence conflict | 24 – 25 | 2 | AP → VS in AAB32284. Ref.2 | ||||||
| Sequence conflict | 32 | 1 | A → S in AAB32284. Ref.2 | ||||||
| Sequence conflict | 38 | 1 | V → A in AAB32284. Ref.2 | ||||||
| Sequence conflict | 42 – 45 | 4 | TPGG → APSS in AAB32284. Ref.2 | ||||||
| Sequence conflict | 136 | 1 | A → G in BAG58415. Ref.7 | ||||||
| Sequence conflict | 193 | 1 | A → D in AAB32284. Ref.2 | ||||||
| Sequence conflict | 223 | 1 | G → T in AAB32284. Ref.2 | ||||||
| Sequence conflict | 285 | 1 | A → P in AAC41688. Ref.1 | ||||||
| Sequence conflict | 368 | 1 | A → T in AAB32284. Ref.2 | ||||||
| Sequence conflict | 434 | 1 | P → R in AAH81558. Ref.9 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, pharmacological characterization, and genomic localization of the human creatine transporter." Nash S.R., Giros B., Kingsmore S.F., Rochelle J.M., Suter S.T., Gregor P., Seldin M.F., Caron M.G. Recept. Channels 2:165-174(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Kidney. |
| [2] | "The cloning and expression of a human creatine transporter." Sora I., Richman J., Santoro G., Wei H., Wang Y., Vanderah T., Horvath R., Nguyen M., Waite S., Roeske W.R. Biochem. Biophys. Res. Commun. 204:419-427(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Brain. |
| [3] | "The genomic organization of a human creatine transporter (CRTR) gene located in Xq28." Sandoval N., Bauer D., Brenner V., Coy J.F., Drescher B., Kioschis P., Korn B., Nyakatura G., Poustka A., Reichwald K., Rosenthal A., Platzer M. Genomics 35:383-385(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Cloning and sequencing of a cDNA encoding a novel member of the human brain GABA/noradrenaline neurotransmitter transporter family." Barnwell L.F., Chaudhuri G., Townsel J.G. Gene 159:287-288(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Hippocampus. |
| [5] | "Identification, characterization and cloning of SLC6A8C, a novel splice variant of the creatine transporter gene." Martinez-Munoz C., Rosenberg E.H., Jakobs C., Salomons G.S. Gene 418:53-59(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [6] | "Genomic organization of the human creatine transporter and CDM genes." Eichler E.E., Lu F., Shen Y., Muzny D.M., Gibbs R.A., Nelson D.L. Submitted (SEP-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Hippocampus. |
| [8] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye and Testis. |
| [10] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [11] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-42, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "X-linked mental retardation with seizures and carrier manifestations is caused by a mutation in the creatine-transporter gene (SLC6A8) located in Xq28." Hahn K.A., Salomons G.S., Tackels-Horne D., Wood T.C., Taylor H.A., Schroer R.J., Lubs H.A., Jakobs C., Olson R.L., Holden K.R., Stevenson R.E., Schwartz C.E. Am. J. Hum. Genet. 70:1349-1356(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT XL-CDS ARG-381. |
| [13] | "X-linked creatine deficiency syndrome: a novel mutation in creatine transporter gene SLC6A8." Bizzi A., Bugiani M., Salomons G.S., Hunneman D.H., Moroni I., Estienne M., Danesi U., Jakobs C., Uziel G. Ann. Neurol. 52:227-231(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT XL-CDS PHE-408 DEL. |
| [14] | "High prevalence of SLC6A8 deficiency in X-linked mental retardation." Rosenberg E.H., Almeida L.S., Kleefstra T., deGrauw R.S., Yntema H.G., Bahi N., Moraine C., Ropers H.-H., Fryns J.-P., deGrauw T.J., Jakobs C., Salomons G.S. Am. J. Hum. Genet. 75:97-105(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS XL-CDS ARG-87; TRP-337; LEU-390 AND LEU-554, VARIANT VAL-560. |
| [15] | "High frequency of creatine deficiency syndromes in patients with unexplained mental retardation." Lion-Francois L., Cheillan D., Pitelet G., Acquaviva-Bourdain C., Bussy G., Cotton F., Guibaud L., Gerard D., Rivier C., Vianey-Saban C., Jakobs C., Salomons G.S., des Portes V. Neurology 67:1713-1714(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS XL-CDS VAL-132 AND TRP-491. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L31409 mRNA. Translation: AAC41688.1. S74039 mRNA. Translation: AAB32284.1. U17986 mRNA. Translation: AAA86990.1. EU280316 mRNA. Translation: ABZ82022.1. AK295495 mRNA. Translation: BAG58415.1. U52111 Genomic DNA. No translation available. Z66539 Genomic DNA. Translation: CAA91442.1. U36341 Genomic DNA. Translation: AAA79507.1. BC012355 mRNA. Translation: AAH12355.1. BC081558 mRNA. Translation: AAH81558.1. |
| IPI | IPI00007582. IPI00011460. IPI01011568. |
| PIR | G02095. JC2386. |
| RefSeq | NP_001136277.1. NM_001142805.1. NP_001136278.1. NM_001142806.1. NP_005620.1. NM_005629.3. |
| UniGene | Hs.540696. |
3D structure databases | |
| ProteinModelPortal | P48029. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000253122. |
PTM databases | |
| PhosphoSite | P48029. |
Polymorphism databases | |
| DMDM | 1352529. |
Proteomic databases | |
| PaxDb | P48029. |
| PRIDE | P48029. |
Protocols and materials databases | |
| DNASU | 6535. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000253122; ENSP00000253122; ENSG00000130821. ENST00000430077; ENSP00000403041; ENSG00000130821. ENST00000597046; ENSP00000470814; ENSG00000268982. ENST00000598634; ENSP00000472369; ENSG00000268982. |
| GeneID | 6535. |
| KEGG | hsa:6535. |
| UCSC | uc004fib.3. human. |
Organism-specific databases | |
| CTD | 6535. |
| GeneCards | GC0XP152953. |
| H-InvDB | HIX0038627. |
| HGNC | HGNC:11055. SLC6A8. |
| HPA | HPA008802. |
| MIM | 300036. gene. 300352. phenotype. |
| neXtProt | NX_P48029. |
| Orphanet | 52503. X-linked creatine transporter deficiency. |
| PharmGKB | PA35915. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0733. |
| HOVERGEN | HBG071421. |
| KO | K05039. |
| OMA | IVFYCNT. |
| OrthoDB | EOG4M3984. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. |
Gene expression databases | |
| ArrayExpress | P48029. |
| Bgee | P48029. |
| CleanEx | HS_SLC6A8. |
| Genevestigator | P48029. |
| GermOnline | ENSG00000130821. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000175. Na/ntran_symport. IPR002984. Na/ntran_symport_creatine. [Graphical view] |
| PANTHER | PTHR11616. PTHR11616. 1 hit. |
| Pfam | PF00209. SNF. 1 hit. [Graphical view] |
| PRINTS | PR01199. CRTTRANSPORT. PR00176. NANEUSMPORT. |
| PROSITE | PS00610. NA_NEUROTRAN_SYMP_1. 1 hit. PS00754. NA_NEUROTRAN_SYMP_2. 1 hit. PS50267. NA_NEUROTRAN_SYMP_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00148. Creatine. |
| GenomeRNAi | 6535. |
| NextBio | 25427. |
| SOURCE | Search... |
Entry information
| Entry name | SC6A8_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P48029 Secondary accession number(s): B2KY47 Q66I36 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
