Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P47930

- FOSL2_MOUSE

UniProt

P47930 - FOSL2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Fos-related antigen 2

Gene

Fosl2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Controls osteoclast survival and size. As a dimer with JUN, activates LIF transcription. Activates CEBPB transcription in PGE2-activated osteoblasts By similarity.By similarity

GO - Molecular functioni

  1. double-stranded DNA binding Source: Ensembl
  2. RNA polymerase II regulatory region sequence-specific DNA binding Source: MGI
  3. sequence-specific DNA binding transcription factor activity Source: Ensembl

GO - Biological processi

  1. cellular response to hormone stimulus Source: Ensembl
  2. female pregnancy Source: Ensembl
  3. positive regulation of fibroblast proliferation Source: MGI
  4. response to cAMP Source: Ensembl
  5. response to corticosterone Source: Ensembl
  6. response to drug Source: Ensembl
  7. response to mechanical stimulus Source: Ensembl
  8. response to morphine Source: Ensembl
  9. response to progesterone Source: Ensembl
  10. transcription from RNA polymerase II promoter Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Fos-related antigen 2
Short name:
FRA-2
Gene namesi
Name:Fosl2
Synonyms:Fra-2, Fra2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 5

Organism-specific databases

MGIiMGI:102858. Fosl2.

Subcellular locationi

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Disruption phenotypei

Mutant pups die within a week after birth. They exhibit severe osteopenia as early as 18.5 dpc, with a 50% decrease in mineralized bone. Osteoblast numbers are not altered. The number, the relative surface covered by osteoclasts and the mean osteoclast surface are increased 3-fold, 5-fold and 2-fold, respectively. Bone resorption activity is increased. This phenotype is due to hypoxia in long bones resulting from placental defects.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 326326Fos-related antigen 2PRO_0000076484Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei104 – 1041N6-acetyllysine1 Publication
Modified residuei120 – 1201PhosphoserineBy similarity
Modified residuei200 – 2001PhosphoserineBy similarity
Modified residuei230 – 2301PhosphoserineBy similarity
Modified residuei320 – 3201PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiP47930.
PRIDEiP47930.

PTM databases

PhosphoSiteiP47930.

Expressioni

Gene expression databases

BgeeiP47930.
CleanExiMM_FOSL2.
GenevestigatoriP47930.

Interactioni

Subunit structurei

Heterodimer; with JUN.

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000031017.

Structurei

3D structure databases

ProteinModelPortaliP47930.
SMRiP47930. Positions 125-187.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini124 – 18764bZIPPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni126 – 1283Basic motifPROSITE-ProRule annotation
Regioni129 – 1368Leucine-zipperPROSITE-ProRule annotation

Sequence similaritiesi

Belongs to the bZIP family. Fos subfamily.Curated
Contains 1 bZIP (basic-leucine zipper) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG301361.
GeneTreeiENSGT00730000110541.
HOGENOMiHOG000234334.
HOVERGENiHBG005743.
InParanoidiP47930.
KOiK09030.
OMAiIKPICLG.
OrthoDBiEOG761BVN.
TreeFamiTF326301.

Family and domain databases

InterProiIPR000837. AP-1.
IPR004827. bZIP.
[Graphical view]
PfamiPF00170. bZIP_1. 1 hit.
[Graphical view]
PRINTSiPR00042. LEUZIPPRFOS.
SMARTiSM00338. BRLZ. 1 hit.
[Graphical view]
PROSITEiPS50217. BZIP. 1 hit.
PS00036. BZIP_BASIC. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P47930-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYQDYPGNFD TSSRGSSGSP AHAESYSSGG GGQQKFRVDM PGSGSAFIPT
60 70 80 90 100
INAITTSQDL QWMVQPTVIT SMSNPYPRSH PYSPLPGLAS VPGHMALPRP
110 120 130 140 150
GVIKTIGTTV GRRRRDEQLS PEEEEKRRIR RERNKLAAAK CRNRRRELTE
160 170 180 190 200
KLQAETEELE EEKSGLQKEI AELQKEKEKL EFMLVAHGPV CKISPEERRS
210 220 230 240 250
PPTSGLQSLR GTGSAVGPVV VKQEPPEEDS PSSSAGMDKT QRSVIKPISI
260 270 280 290 300
AGGGFYGEEP LHTPIVVTST PAITPGTSNL VFTYPNVLEQ ESPSSPSESC
310 320
SKAHRRSSSS GDQSSDSLNS PTLLAL
Length:326
Mass (Da):35,298
Last modified:July 27, 2011 - v2
Checksum:i05B0F20D7D0B790A
GO
Isoform 2 (identifier: P47930-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQ → MSFSLF

Note: No experimental confirmation available.

Show »
Length:299
Mass (Da):32,687
Checksum:i4879B6E93597B61E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti184 – 1841L → K in CAA58805. (PubMed:7936655)Curated
Sequence conflicti267 – 2671V → E in BAE26674. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3333MYQDY…GGGGQ → MSFSLF in isoform 2. 1 PublicationVSP_042084Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X83971 mRNA. Translation: CAA58805.1.
X83970 Genomic DNA. Translation: CAA58804.1.
AK089371 mRNA. Translation: BAC40860.1.
AK145822 mRNA. Translation: BAE26674.1.
BC065131 mRNA. Translation: AAH65131.1.
CCDSiCCDS19190.1. [P47930-1]
PIRiI48351.
RefSeqiNP_032063.2. NM_008037.4. [P47930-1]
UniGeneiMm.24684.

Genome annotation databases

EnsembliENSMUST00000031017; ENSMUSP00000031017; ENSMUSG00000029135. [P47930-1]
GeneIDi14284.
KEGGimmu:14284.
UCSCiuc008wzi.2. mouse. [P47930-1]
uc008wzj.1. mouse. [P47930-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X83971 mRNA. Translation: CAA58805.1 .
X83970 Genomic DNA. Translation: CAA58804.1 .
AK089371 mRNA. Translation: BAC40860.1 .
AK145822 mRNA. Translation: BAE26674.1 .
BC065131 mRNA. Translation: AAH65131.1 .
CCDSi CCDS19190.1. [P47930-1 ]
PIRi I48351.
RefSeqi NP_032063.2. NM_008037.4. [P47930-1 ]
UniGenei Mm.24684.

3D structure databases

ProteinModelPortali P47930.
SMRi P47930. Positions 125-187.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10090.ENSMUSP00000031017.

PTM databases

PhosphoSitei P47930.

Proteomic databases

MaxQBi P47930.
PRIDEi P47930.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000031017 ; ENSMUSP00000031017 ; ENSMUSG00000029135 . [P47930-1 ]
GeneIDi 14284.
KEGGi mmu:14284.
UCSCi uc008wzi.2. mouse. [P47930-1 ]
uc008wzj.1. mouse. [P47930-2 ]

Organism-specific databases

CTDi 2355.
MGIi MGI:102858. Fosl2.

Phylogenomic databases

eggNOGi NOG301361.
GeneTreei ENSGT00730000110541.
HOGENOMi HOG000234334.
HOVERGENi HBG005743.
InParanoidi P47930.
KOi K09030.
OMAi IKPICLG.
OrthoDBi EOG761BVN.
TreeFami TF326301.

Miscellaneous databases

NextBioi 285669.
PROi P47930.
SOURCEi Search...

Gene expression databases

Bgeei P47930.
CleanExi MM_FOSL2.
Genevestigatori P47930.

Family and domain databases

InterProi IPR000837. AP-1.
IPR004827. bZIP.
[Graphical view ]
Pfami PF00170. bZIP_1. 1 hit.
[Graphical view ]
PRINTSi PR00042. LEUZIPPRFOS.
SMARTi SM00338. BRLZ. 1 hit.
[Graphical view ]
PROSITEi PS50217. BZIP. 1 hit.
PS00036. BZIP_BASIC. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterisation of the mouse fra-2 gene."
    Foletta V.C., Sonobe M.H., Suzuki T., Endo T., Iba H., Cohen D.R.
    Oncogene 9:3305-3311(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
    Strain: C57BL/6.
    Tissue: Liver.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Dendritic cell and Placenta.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6.
    Tissue: Brain.
  4. "Osteoclast size is controlled by Fra-2 through LIF/LIF-receptor signalling and hypoxia."
    Bozec A., Bakiri L., Hoebertz A., Eferl R., Schilling A.F., Komnenovic V., Scheuch H., Priemel M., Stewart C.L., Amling M., Wagner E.F.
    Nature 454:221-225(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, HETERODIMERIZATION WITH JUN, DISRUPTION PHENOTYPE.
  5. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
    Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
    Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.
  6. "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways."
    Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.
    Mol. Cell 50:919-930(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-104, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.

Entry informationi

Entry nameiFOSL2_MOUSE
AccessioniPrimary (citable) accession number: P47930
Secondary accession number(s): Q3UKX7, Q8C231
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: July 27, 2011
Last modified: October 29, 2014
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3