Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P47930

- FOSL2_MOUSE

UniProt

P47930 - FOSL2_MOUSE

Protein

Fos-related antigen 2

Gene

Fosl2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 101 (01 Oct 2014)
      Sequence version 2 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Controls osteoclast survival and size. As a dimer with JUN, activates LIF transcription. Activates CEBPB transcription in PGE2-activated osteoblasts By similarity.By similarity

    GO - Molecular functioni

    1. double-stranded DNA binding Source: Ensembl
    2. RNA polymerase II regulatory region sequence-specific DNA binding Source: MGI
    3. sequence-specific DNA binding transcription factor activity Source: Ensembl

    GO - Biological processi

    1. cellular response to hormone stimulus Source: Ensembl
    2. female pregnancy Source: Ensembl
    3. positive regulation of fibroblast proliferation Source: MGI
    4. response to cAMP Source: Ensembl
    5. response to corticosterone Source: Ensembl
    6. response to drug Source: Ensembl
    7. response to mechanical stimulus Source: Ensembl
    8. response to morphine Source: Ensembl
    9. response to progesterone Source: Ensembl
    10. transcription from RNA polymerase II promoter Source: Ensembl

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Fos-related antigen 2
    Short name:
    FRA-2
    Gene namesi
    Name:Fosl2
    Synonyms:Fra-2, Fra2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 5

    Organism-specific databases

    MGIiMGI:102858. Fosl2.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Disruption phenotypei

    Mutant pups die within a week after birth. They exhibit severe osteopenia as early as 18.5 dpc, with a 50% decrease in mineralized bone. Osteoblast numbers are not altered. The number, the relative surface covered by osteoclasts and the mean osteoclast surface are increased 3-fold, 5-fold and 2-fold, respectively. Bone resorption activity is increased. This phenotype is due to hypoxia in long bones resulting from placental defects.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 326326Fos-related antigen 2PRO_0000076484Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionineBy similarity
    Modified residuei104 – 1041N6-acetyllysine1 Publication
    Modified residuei120 – 1201PhosphoserineBy similarity
    Modified residuei200 – 2001PhosphoserineBy similarity
    Modified residuei230 – 2301PhosphoserineBy similarity
    Modified residuei320 – 3201PhosphoserineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    PRIDEiP47930.

    PTM databases

    PhosphoSiteiP47930.

    Expressioni

    Gene expression databases

    BgeeiP47930.
    CleanExiMM_FOSL2.
    GenevestigatoriP47930.

    Interactioni

    Subunit structurei

    Heterodimer; with JUN.

    Protein-protein interaction databases

    STRINGi10090.ENSMUSP00000031017.

    Structurei

    3D structure databases

    ProteinModelPortaliP47930.
    SMRiP47930. Positions 125-187.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini124 – 18764bZIPPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni126 – 1283Basic motifPROSITE-ProRule annotation
    Regioni129 – 1368Leucine-zipperPROSITE-ProRule annotation

    Sequence similaritiesi

    Belongs to the bZIP family. Fos subfamily.Curated
    Contains 1 bZIP (basic-leucine zipper) domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG301361.
    GeneTreeiENSGT00730000110541.
    HOGENOMiHOG000234334.
    HOVERGENiHBG005743.
    InParanoidiQ8C231.
    KOiK09030.
    OMAiIKPICLG.
    OrthoDBiEOG761BVN.
    TreeFamiTF326301.

    Family and domain databases

    InterProiIPR004827. bZIP.
    IPR000837. Leuzip_Fos.
    [Graphical view]
    PfamiPF00170. bZIP_1. 1 hit.
    [Graphical view]
    PRINTSiPR00042. LEUZIPPRFOS.
    SMARTiSM00338. BRLZ. 1 hit.
    [Graphical view]
    PROSITEiPS50217. BZIP. 1 hit.
    PS00036. BZIP_BASIC. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P47930-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MYQDYPGNFD TSSRGSSGSP AHAESYSSGG GGQQKFRVDM PGSGSAFIPT    50
    INAITTSQDL QWMVQPTVIT SMSNPYPRSH PYSPLPGLAS VPGHMALPRP 100
    GVIKTIGTTV GRRRRDEQLS PEEEEKRRIR RERNKLAAAK CRNRRRELTE 150
    KLQAETEELE EEKSGLQKEI AELQKEKEKL EFMLVAHGPV CKISPEERRS 200
    PPTSGLQSLR GTGSAVGPVV VKQEPPEEDS PSSSAGMDKT QRSVIKPISI 250
    AGGGFYGEEP LHTPIVVTST PAITPGTSNL VFTYPNVLEQ ESPSSPSESC 300
    SKAHRRSSSS GDQSSDSLNS PTLLAL 326
    Length:326
    Mass (Da):35,298
    Last modified:July 27, 2011 - v2
    Checksum:i05B0F20D7D0B790A
    GO
    Isoform 2 (identifier: P47930-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-33: MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQ → MSFSLF

    Note: No experimental confirmation available.

    Show »
    Length:299
    Mass (Da):32,687
    Checksum:i4879B6E93597B61E
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti184 – 1841L → K in CAA58805. (PubMed:7936655)Curated
    Sequence conflicti267 – 2671V → E in BAE26674. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3333MYQDY…GGGGQ → MSFSLF in isoform 2. 1 PublicationVSP_042084Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X83971 mRNA. Translation: CAA58805.1.
    X83970 Genomic DNA. Translation: CAA58804.1.
    AK089371 mRNA. Translation: BAC40860.1.
    AK145822 mRNA. Translation: BAE26674.1.
    BC065131 mRNA. Translation: AAH65131.1.
    CCDSiCCDS19190.1. [P47930-1]
    PIRiI48351.
    RefSeqiNP_032063.2. NM_008037.4. [P47930-1]
    UniGeneiMm.24684.

    Genome annotation databases

    EnsembliENSMUST00000031017; ENSMUSP00000031017; ENSMUSG00000029135. [P47930-1]
    GeneIDi14284.
    KEGGimmu:14284.
    UCSCiuc008wzi.2. mouse. [P47930-1]
    uc008wzj.1. mouse. [P47930-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X83971 mRNA. Translation: CAA58805.1 .
    X83970 Genomic DNA. Translation: CAA58804.1 .
    AK089371 mRNA. Translation: BAC40860.1 .
    AK145822 mRNA. Translation: BAE26674.1 .
    BC065131 mRNA. Translation: AAH65131.1 .
    CCDSi CCDS19190.1. [P47930-1 ]
    PIRi I48351.
    RefSeqi NP_032063.2. NM_008037.4. [P47930-1 ]
    UniGenei Mm.24684.

    3D structure databases

    ProteinModelPortali P47930.
    SMRi P47930. Positions 125-187.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10090.ENSMUSP00000031017.

    PTM databases

    PhosphoSitei P47930.

    Proteomic databases

    PRIDEi P47930.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000031017 ; ENSMUSP00000031017 ; ENSMUSG00000029135 . [P47930-1 ]
    GeneIDi 14284.
    KEGGi mmu:14284.
    UCSCi uc008wzi.2. mouse. [P47930-1 ]
    uc008wzj.1. mouse. [P47930-2 ]

    Organism-specific databases

    CTDi 2355.
    MGIi MGI:102858. Fosl2.

    Phylogenomic databases

    eggNOGi NOG301361.
    GeneTreei ENSGT00730000110541.
    HOGENOMi HOG000234334.
    HOVERGENi HBG005743.
    InParanoidi Q8C231.
    KOi K09030.
    OMAi IKPICLG.
    OrthoDBi EOG761BVN.
    TreeFami TF326301.

    Miscellaneous databases

    NextBioi 285669.
    PROi P47930.
    SOURCEi Search...

    Gene expression databases

    Bgeei P47930.
    CleanExi MM_FOSL2.
    Genevestigatori P47930.

    Family and domain databases

    InterProi IPR004827. bZIP.
    IPR000837. Leuzip_Fos.
    [Graphical view ]
    Pfami PF00170. bZIP_1. 1 hit.
    [Graphical view ]
    PRINTSi PR00042. LEUZIPPRFOS.
    SMARTi SM00338. BRLZ. 1 hit.
    [Graphical view ]
    PROSITEi PS50217. BZIP. 1 hit.
    PS00036. BZIP_BASIC. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterisation of the mouse fra-2 gene."
      Foletta V.C., Sonobe M.H., Suzuki T., Endo T., Iba H., Cohen D.R.
      Oncogene 9:3305-3311(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
      Strain: C57BL/6.
      Tissue: Liver.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: C57BL/6J.
      Tissue: Dendritic cell and Placenta.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6.
      Tissue: Brain.
    4. "Osteoclast size is controlled by Fra-2 through LIF/LIF-receptor signalling and hypoxia."
      Bozec A., Bakiri L., Hoebertz A., Eferl R., Schilling A.F., Komnenovic V., Scheuch H., Priemel M., Stewart C.L., Amling M., Wagner E.F.
      Nature 454:221-225(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, HETERODIMERIZATION WITH JUN, DISRUPTION PHENOTYPE.
    5. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
      Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
      Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic fibroblast.
    6. "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways."
      Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.
      Mol. Cell 50:919-930(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-104, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic fibroblast.

    Entry informationi

    Entry nameiFOSL2_MOUSE
    AccessioniPrimary (citable) accession number: P47930
    Secondary accession number(s): Q3UKX7, Q8C231
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1996
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 101 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3