Reviewed,
UniProtKB/Swiss-Prot P47870 (GBRB2_HUMAN)
Last modified
February 9, 2010.
Version 95.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Gamma-aminobutyric acid receptor subunit beta-2 Alternative name(s): GABA(A) receptor subunit beta-2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 474 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. |
| Subunit structure | Generally pentameric. There are five types of GABA(A) receptor chains: alpha, beta, gamma, delta, and rho. Binds UBQLN1. |
| Subcellular location | Cell junction › synapse › postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. |
| Sequence similarities | Belongs to the ligand-gated ionic channel (TC 1.A.9) family. [View classification] |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Short (identifier: P47870-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Long (identifier: P47870-2) The sequence of this isoform differs from the canonical sequence as follows: 359-359: K → KIFYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | By similarity | ||||||||
| Chain | 26 – 474 | 449 | Gamma-aminobutyric acid receptor subunit beta-2 | PRO_0000000459 | |||||||
Regions | |||||||||||
| Topological domain | 26 – 244 | 219 | Extracellular Probable | ||||||||
| Transmembrane | 245 – 266 | 22 | Probable | ||||||||
| Transmembrane | 270 – 292 | 23 | Probable | ||||||||
| Transmembrane | 304 – 326 | 23 | Probable | ||||||||
| Topological domain | 327 – 451 | 125 | Cytoplasmic Probable | ||||||||
| Transmembrane | 452 – 473 | 22 | Probable | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 396 | 1 | Phosphotyrosine By similarity | ||||||||
| Modified residue | 403 | 1 | Phosphotyrosine By similarity | ||||||||
| Glycosylation | 32 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 104 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 173 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 160 ↔ 174 | By similarity | |||||||||
| Cross-link | 45 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.6 | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 359 | 1 | K → KIFYKDIKQNGTQYRSLWDP TGNLSPTRRTTNYDFSLYT in isoform Long. | VSP_000087 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Role of the beta subunit in determining the pharmacology of human gamma-aminobutyric acid type A receptors." Hadingham K.L., Wingrove P.B., Wafford K.A., Bain C., Kemp J.A., Palmer K.J., Wilson A.W., Wilcox A.S., Sikela J.M., Ragan C.I. Mol. Pharmacol. 44:1211-1218(1993) [PubMed: 8264558] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). Tissue: Brain. |
| [2] | "Cloning, sequence analysis and expression of two forms of mRNA coding for the human beta 2 subunit of the GABAA receptor." McKinley D.D., Lennon D.J., Carter D.B. Brain Res. Mol. Brain Res. 28:175-179(1995) [PubMed: 7707873] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). Tissue: Brain. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). |
| [6] | "Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry." Denis N.J., Vasilescu J., Lambert J.-P., Smith J.C., Figeys D. Proteomics 7:868-874(2007) [PubMed: 17370265] [Abstract] Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-45, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | S67368 mRNA. Translation: AAB29370.1. S77554 mRNA. Translation: AAB33983.1. S77553 mRNA. Translation: AAB33982.1. AK289815 mRNA. Translation: BAF82504.1. CH471062 Genomic DNA. Translation: EAW61543.1. BC099705 mRNA. Translation: AAH99705.1. BC099719 mRNA. Translation: AAH99719.1. BC105639 mRNA. Translation: AAI05640.1. |
| IPI | IPI00026639. IPI00216394. |
| PIR | I52656. |
| RefSeq | NP_000804.1. NP_068711.1. |
| UniGene | Hs.303527 |
3D structure databases | |
| SMR | P47870. Positions 37-339. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P47870. |
Protein family/group databases | |
| TCDB | 1.A.9.5.2. neurotransmitter receptor, cys loop, ligand-gated ion channel (LIC) family. |
PTM databases | |
| PhosphoSite | P47870. |
Proteomic databases | |
| PeptideAtlas | P47870. |
| PRIDE | P47870. |
Genome annotation databases | |
| Ensembl | ENST00000353437; ENSP00000274546; ENSG00000145864; Homo sapiens. [Genome view] |
| GeneID | 2561. |
| KEGG | hsa:2561. |
| UCSC | uc003lyr.1. human. uc003lys.1. human. |
Organism-specific databases | |
| CTD | 2561. |
| GeneCards | GC05M160653. |
| H-InvDB | HIX0032109. |
| HGNC | HGNC:4082. GABRB2. |
| HPA | CAB001964. |
| MIM | 600232. gene. |
| PharmGKB | PA28496. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG19114. |
| HOVERGEN | P47870. |
| OMA | TSSIQYR. |
Gene expression databases | |
| ArrayExpress | P47870. |
| Bgee | P47870. |
| CleanEx | HS_GABRB2. |
| Genevestigator | P47870. |
| GermOnline | ENSG00000145864. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006028. GABAA_rcpt. IPR002289. GABAAb_rcpt. IPR006202. Neur_chan_lig_bd. IPR006201. Neur_channel. IPR006029. Neurotrans-gated_channel_TM. IPR018000. Neurotransmitter_ion_chnl_CS. [Graphical view] |
| Gene3D | G3DSA:2.70.170.10. Neur_chan_lig_bd. 1 hit. |
| PANTHER | PTHR18945. Neur_channel. 1 hit. |
| Pfam | PF02931. Neur_chan_LBD. 1 hit. PF02932. Neur_chan_memb. 1 hit. [Graphical view] |
| PRINTS | PR01160. GABAARBETA. PR00253. GABAARECEPTR. PR00252. NRIONCHANNEL. |
| TIGRFAMs | TIGR00860. LIC. 1 hit. |
| PROSITE | PS00236. NEUROTR_ION_CHANNEL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| DrugBank | DB00189. Ethchlorvynol. DB00690. Flurazepam. DB00186. Lorazepam. DB00683. Midazolam. |
| NextBio | 10115. |
| SOURCE | Search... |
Entry information
| Entry name | GBRB2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P47870 Secondary accession number(s): A8K1A0, Q16323, Q4FZB2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Protein Spotlight Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


