Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P47869

- GBRA2_HUMAN

UniProt

P47869 - GBRA2_HUMAN

Protein

Gamma-aminobutyric acid receptor subunit alpha-2

Gene

GABRA2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 139 (01 Oct 2014)
      Sequence version 2 (20 Feb 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.

    GO - Molecular functioni

    1. benzodiazepine receptor activity Source: UniProtKB
    2. chloride channel activity Source: UniProtKB-KW
    3. extracellular ligand-gated ion channel activity Source: InterPro
    4. GABA-A receptor activity Source: InterPro

    GO - Biological processi

    1. gamma-aminobutyric acid signaling pathway Source: UniProtKB
    2. ion transmembrane transport Source: Reactome
    3. neurotransmitter transport Source: UniProtKB
    4. regulation of neurotransmitter levels Source: UniProtKB
    5. synaptic transmission Source: Reactome
    6. transmembrane transport Source: Reactome

    Keywords - Molecular functioni

    Chloride channel, Ion channel, Ligand-gated ion channel, Receptor

    Keywords - Biological processi

    Ion transport, Transport

    Keywords - Ligandi

    Chloride

    Enzyme and pathway databases

    ReactomeiREACT_24987. GABA A receptor activation.
    REACT_25387. Ligand-gated ion channel transport.

    Protein family/group databases

    TCDBi1.A.9.5.2. the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Gamma-aminobutyric acid receptor subunit alpha-2
    Alternative name(s):
    GABA(A) receptor subunit alpha-2
    Gene namesi
    Name:GABRA2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:4076. GABRA2.

    Subcellular locationi

    GO - Cellular componenti

    1. axon Source: Ensembl
    2. cell junction Source: UniProtKB-KW
    3. chloride channel complex Source: UniProtKB-KW
    4. integral component of synaptic vesicle membrane Source: UniProtKB
    5. plasma membrane Source: Reactome
    6. postsynaptic membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Organism-specific databases

    MIMi103780. phenotype.
    PharmGKBiPA28490.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2828Sequence AnalysisAdd
    BLAST
    Chaini29 – 451423Gamma-aminobutyric acid receptor subunit alpha-2PRO_0000000433Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi38 – 381N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi138 – 1381N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi166 ↔ 180By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiP47869.
    PRIDEiP47869.

    PTM databases

    PhosphoSiteiP47869.

    Expressioni

    Gene expression databases

    ArrayExpressiP47869.
    BgeeiP47869.
    CleanExiHS_GABRA2.
    GenevestigatoriP47869.

    Organism-specific databases

    HPAiHPA014261.

    Interactioni

    Subunit structurei

    Binds UBQLN1 By similarity. Generally pentameric. There are five types of GABA(A) receptor chains: alpha, beta, gamma, delta, and rho.By similarity

    Protein-protein interaction databases

    BioGridi108829. 2 interactions.
    IntActiP47869. 1 interaction.
    STRINGi9606.ENSP00000348897.

    Structurei

    3D structure databases

    ProteinModelPortaliP47869.
    SMRiP47869. Positions 43-359.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini29 – 251223ExtracellularCuratedAdd
    BLAST
    Topological domaini335 – 41985CytoplasmicCuratedAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei252 – 27322HelicalCuratedAdd
    BLAST
    Transmembranei279 – 30022HelicalCuratedAdd
    BLAST
    Transmembranei313 – 33422HelicalCuratedAdd
    BLAST
    Transmembranei420 – 44122HelicalCuratedAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG238757.
    HOGENOMiHOG000231337.
    HOVERGENiHBG051707.
    InParanoidiP47869.
    KOiK05175.
    OrthoDBiEOG7JX342.
    PhylomeDBiP47869.
    TreeFamiTF315453.

    Family and domain databases

    Gene3Di2.70.170.10. 1 hit.
    InterProiIPR006028. GABAA/Glycine_rcpt.
    IPR001390. GABAAa_rcpt.
    IPR005432. GABBAa2_rcpt.
    IPR006202. Neur_chan_lig-bd.
    IPR006201. Neur_channel.
    IPR006029. Neurotrans-gated_channel_TM.
    IPR018000. Neurotransmitter_ion_chnl_CS.
    [Graphical view]
    PANTHERiPTHR18945. PTHR18945. 1 hit.
    PfamiPF02931. Neur_chan_LBD. 1 hit.
    PF02932. Neur_chan_memb. 2 hits.
    [Graphical view]
    PRINTSiPR01079. GABAARALPHA.
    PR01615. GABAARALPHA2.
    PR00253. GABAARECEPTR.
    PR00252. NRIONCHANNEL.
    SUPFAMiSSF63712. SSF63712. 1 hit.
    SSF90112. SSF90112. 1 hit.
    TIGRFAMsiTIGR00860. LIC. 1 hit.
    PROSITEiPS00236. NEUROTR_ION_CHANNEL. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P47869-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKTKLNIYNM QFLLFVFLVW DPARLVLANI QEDEAKNNIT IFTRILDRLL    50
    DGYDNRLRPG LGDSITEVFT NIYVTSFGPV SDTDMEYTID VFFRQKWKDE 100
    RLKFKGPMNI LRLNNLMASK IWTPDTFFHN GKKSVAHNMT MPNKLLRIQD 150
    DGTLLYTMRL TVQAECPMHL EDFPMDAHSC PLKFGSYAYT TSEVTYIWTY 200
    NASDSVQVAP DGSRLNQYDL LGQSIGKETI KSSTGEYTVM TAHFHLKRKI 250
    GYFVIQTYLP CIMTVILSQV SFWLNRESVP ARTVFGVTTV LTMTTLSISA 300
    RNSLPKVAYA TAMDWFIAVC YAFVFSALIE FATVNYFTKR GWAWDGKSVV 350
    NDKKKEKASV MIQNNAYAVA VANYAPNLSK DPVLSTISKS ATTPEPNKKP 400
    ENKPAEAKKT FNSVSKIDRM SRIVFPVLFG TFNLVYWATY LNREPVLGVS 450
    P 451
    Length:451
    Mass (Da):51,326
    Last modified:February 20, 2007 - v2
    Checksum:i43F9F708B5A00FFD
    GO
    Isoform 2 (identifier: P47869-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-85: MKTKLNIYNM...SFGPVSDTDM → MRLKITLPSLREFLTDFWMVTIIGLDQDWE
         353-353: K → KSPSIKAEGITLTYNSVKAILQGAKLIWSKYIAFSWPSLFQEKTLEYLEKWMDCLTFKQSS

    Note: No experimental confirmation available.

    Show »
    Length:456
    Mass (Da):52,064
    Checksum:i040306CCB7836206
    GO

    Sequence cautioni

    The sequence BAD92532.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti10 – 112MQ → IE in AAB27278. (PubMed:8391122)Curated
    Sequence conflicti343 – 3431A → T in AAB27278. (PubMed:8391122)Curated

    Polymorphismi

    Genetic variations in GABRA2 determine the genetic susceptibility to alcoholism [MIMi:103780].

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 8585MKTKL…SDTDM → MRLKITLPSLREFLTDFWMV TIIGLDQDWE in isoform 2. 1 PublicationVSP_054277Add
    BLAST
    Alternative sequencei353 – 3531K → KSPSIKAEGITLTYNSVKAI LQGAKLIWSKYIAFSWPSLF QEKTLEYLEKWMDCLTFKQS S in isoform 2. 1 PublicationVSP_054278

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    S62907 mRNA. Translation: AAB27278.1.
    AK125179 mRNA. Translation: BAG54159.1.
    AK289662 mRNA. Translation: BAF82351.1.
    AK293466 mRNA. Translation: BAH11514.1.
    AB209295 mRNA. Translation: BAD92532.1. Different initiation.
    AC084352 Genomic DNA. No translation available.
    AC093745 Genomic DNA. No translation available.
    AC095060 Genomic DNA. No translation available.
    AC104072 Genomic DNA. No translation available.
    CH471069 Genomic DNA. Translation: EAW93022.1.
    CCDSiCCDS3471.1. [P47869-1]
    CCDS68692.1. [P47869-2]
    PIRiI57947.
    RefSeqiNP_000798.2. NM_000807.2. [P47869-1]
    NP_001107647.1. NM_001114175.1. [P47869-1]
    NP_001273756.1. NM_001286827.1. [P47869-2]
    XP_006714065.1. XM_006714002.1. [P47869-1]
    UniGeneiHs.116250.

    Genome annotation databases

    EnsembliENST00000356504; ENSP00000348897; ENSG00000151834. [P47869-1]
    ENST00000381620; ENSP00000371033; ENSG00000151834. [P47869-1]
    ENST00000510861; ENSP00000421828; ENSG00000151834. [P47869-1]
    ENST00000514090; ENSP00000421300; ENSG00000151834. [P47869-1]
    ENST00000540012; ENSP00000444409; ENSG00000151834. [P47869-2]
    GeneIDi2555.
    KEGGihsa:2555.
    UCSCiuc003gxc.3. human. [P47869-1]

    Polymorphism databases

    DMDMi126302547.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Protein Spotlight

    Forbidden fruit - Issue 56 of March 2005

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    S62907 mRNA. Translation: AAB27278.1 .
    AK125179 mRNA. Translation: BAG54159.1 .
    AK289662 mRNA. Translation: BAF82351.1 .
    AK293466 mRNA. Translation: BAH11514.1 .
    AB209295 mRNA. Translation: BAD92532.1 . Different initiation.
    AC084352 Genomic DNA. No translation available.
    AC093745 Genomic DNA. No translation available.
    AC095060 Genomic DNA. No translation available.
    AC104072 Genomic DNA. No translation available.
    CH471069 Genomic DNA. Translation: EAW93022.1 .
    CCDSi CCDS3471.1. [P47869-1 ]
    CCDS68692.1. [P47869-2 ]
    PIRi I57947.
    RefSeqi NP_000798.2. NM_000807.2. [P47869-1 ]
    NP_001107647.1. NM_001114175.1. [P47869-1 ]
    NP_001273756.1. NM_001286827.1. [P47869-2 ]
    XP_006714065.1. XM_006714002.1. [P47869-1 ]
    UniGenei Hs.116250.

    3D structure databases

    ProteinModelPortali P47869.
    SMRi P47869. Positions 43-359.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 108829. 2 interactions.
    IntActi P47869. 1 interaction.
    STRINGi 9606.ENSP00000348897.

    Chemistry

    BindingDBi P47869.
    ChEMBLi CHEMBL2094130.
    DrugBanki DB00659. Acamprosate.
    DB00546. Adinazolam.
    DB00404. Alprazolam.
    DB01351. Amobarbital.
    DB00543. Amoxapine.
    DB01352. Aprobarbital.
    DB01558. Bromazepam.
    DB00237. Butabarbital.
    DB00241. Butalbital.
    DB01353. Butethal.
    DB00475. Chlordiazepoxide.
    DB01594. Cinolazepam.
    DB00349. Clobazam.
    DB01068. Clonazepam.
    DB00628. Clorazepate.
    DB01559. Clotiazepam.
    DB01189. Desflurane.
    DB00829. Diazepam.
    DB00228. Enflurane.
    DB01049. Ergoloid mesylate.
    DB01215. Estazolam.
    DB00402. Eszopiclone.
    DB00189. Ethchlorvynol.
    DB00292. Etomidate.
    DB01567. Fludiazepam.
    DB01205. Flumazenil.
    DB01544. Flunitrazepam.
    DB00690. Flurazepam.
    DB01437. Glutethimide.
    DB00801. Halazepam.
    DB01159. Halothane.
    DB01354. Heptabarbital.
    DB01355. Hexobarbital.
    DB00753. Isoflurane.
    DB00186. Lorazepam.
    DB00371. Meprobamate.
    DB01028. Methoxyflurane.
    DB00849. Methylphenobarbital.
    DB01107. Methyprylon.
    DB00683. Midazolam.
    DB01595. Nitrazepam.
    DB00334. Olanzapine.
    DB00842. Oxazepam.
    DB00312. Pentobarbital.
    DB01588. Prazepam.
    DB00794. Primidone.
    DB00818. Propofol.
    DB01589. Quazepam.
    DB01346. Quinidine barbiturate.
    DB00418. Secobarbital.
    DB01236. Sevoflurane.
    DB00306. Talbutal.
    DB00231. Temazepam.
    DB00599. Thiopental.
    DB00273. Topiramate.
    DB00897. Triazolam.
    DB00425. Zolpidem.
    DB01198. Zopiclone.
    GuidetoPHARMACOLOGYi 405.

    Protein family/group databases

    TCDBi 1.A.9.5.2. the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family.

    PTM databases

    PhosphoSitei P47869.

    Polymorphism databases

    DMDMi 126302547.

    Proteomic databases

    PaxDbi P47869.
    PRIDEi P47869.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000356504 ; ENSP00000348897 ; ENSG00000151834 . [P47869-1 ]
    ENST00000381620 ; ENSP00000371033 ; ENSG00000151834 . [P47869-1 ]
    ENST00000510861 ; ENSP00000421828 ; ENSG00000151834 . [P47869-1 ]
    ENST00000514090 ; ENSP00000421300 ; ENSG00000151834 . [P47869-1 ]
    ENST00000540012 ; ENSP00000444409 ; ENSG00000151834 . [P47869-2 ]
    GeneIDi 2555.
    KEGGi hsa:2555.
    UCSCi uc003gxc.3. human. [P47869-1 ]

    Organism-specific databases

    CTDi 2555.
    GeneCardsi GC04M046167.
    HGNCi HGNC:4076. GABRA2.
    HPAi HPA014261.
    MIMi 103780. phenotype.
    137140. gene.
    neXtProti NX_P47869.
    PharmGKBi PA28490.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG238757.
    HOGENOMi HOG000231337.
    HOVERGENi HBG051707.
    InParanoidi P47869.
    KOi K05175.
    OrthoDBi EOG7JX342.
    PhylomeDBi P47869.
    TreeFami TF315453.

    Enzyme and pathway databases

    Reactomei REACT_24987. GABA A receptor activation.
    REACT_25387. Ligand-gated ion channel transport.

    Miscellaneous databases

    ChiTaRSi GABRA2. human.
    GeneWikii GABRA2.
    GenomeRNAii 2555.
    NextBioi 10091.
    PROi P47869.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P47869.
    Bgeei P47869.
    CleanExi HS_GABRA2.
    Genevestigatori P47869.

    Family and domain databases

    Gene3Di 2.70.170.10. 1 hit.
    InterProi IPR006028. GABAA/Glycine_rcpt.
    IPR001390. GABAAa_rcpt.
    IPR005432. GABBAa2_rcpt.
    IPR006202. Neur_chan_lig-bd.
    IPR006201. Neur_channel.
    IPR006029. Neurotrans-gated_channel_TM.
    IPR018000. Neurotransmitter_ion_chnl_CS.
    [Graphical view ]
    PANTHERi PTHR18945. PTHR18945. 1 hit.
    Pfami PF02931. Neur_chan_LBD. 1 hit.
    PF02932. Neur_chan_memb. 2 hits.
    [Graphical view ]
    PRINTSi PR01079. GABAARALPHA.
    PR01615. GABAARALPHA2.
    PR00253. GABAARECEPTR.
    PR00252. NRIONCHANNEL.
    SUPFAMi SSF63712. SSF63712. 1 hit.
    SSF90112. SSF90112. 1 hit.
    TIGRFAMsi TIGR00860. LIC. 1 hit.
    PROSITEi PS00236. NEUROTR_ION_CHANNEL. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning of cDNA sequences encoding human alpha 2 and alpha 3 gamma-aminobutyric acidA receptor subunits and characterization of the benzodiazepine pharmacology of recombinant alpha 1-, alpha 2-, alpha 3-, and alpha 5-containing human gamma-aminobutyric acidA receptors."
      Hadingham K.L., Wingrove P., le Bourdelles B., Palmer K.J., Ragan C.I., Whiting P.J.
      Mol. Pharmacol. 43:970-975(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Amygdala, Brain and Cerebellum.
    4. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "Variations in GABRA2, encoding the alpha 2 subunit of the GABA(A) receptor, are associated with alcohol dependence and with brain oscillations."
      Edenberg H.J., Dick D.M., Xuei X., Tian H., Almasy L., Bauer L.O., Crowe R.R., Goate A., Hesselbrock V., Jones K., Kwon J., Li T.-K., Nurnberger J.I. Jr., O'Connor S.J., Reich T., Rice J., Schuckit M.A., Porjesz B., Foroud T., Begleiter H.
      Am. J. Hum. Genet. 74:705-714(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN SUSCEPTIBILITY TO ALCOHOLISM.

    Entry informationi

    Entry nameiGBRA2_HUMAN
    AccessioniPrimary (citable) accession number: P47869
    Secondary accession number(s): A8K0U7, B7Z1H8, Q59G14
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1996
    Last sequence update: February 20, 2007
    Last modified: October 1, 2014
    This is version 139 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. Protein Spotlight
      Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3