Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P47857

- PFKAM_MOUSE

UniProt

P47857 - PFKAM_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

ATP-dependent 6-phosphofructokinase, muscle type

Gene

Pfkm

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.1 PublicationUniRule annotation

Catalytic activityi

ATP + D-fructose 6-phosphate = ADP + D-fructose 1,6-bisphosphate.1 PublicationUniRule annotation

Cofactori

Magnesium.

Enzyme regulationi

Allosterically activated by ADP, AMP, or fructose 2,6-bisphosphate, and allosterically inhibited by ATP or citrate.UniRule annotation

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei25 – 251ATP; via amide nitrogenUniRule annotation
Metal bindingi119 – 1191Magnesium; catalyticUniRule annotation
Active sitei166 – 1661Proton acceptorUniRule annotation
Binding sitei201 – 2011Substrate; shared with dimeric partnerUniRule annotation
Binding sitei264 – 2641SubstrateUniRule annotation
Binding sitei292 – 2921Substrate; shared with dimeric partnerUniRule annotation
Binding sitei471 – 4711Allosteric activator fructose 2,6-bisphosphateUniRule annotation
Binding sitei566 – 5661Allosteric activator fructose 2,6-bisphosphate; shared with dimeric partnerUniRule annotation
Binding sitei629 – 6291Allosteric activator fructose 2,6-bisphosphateUniRule annotation
Binding sitei655 – 6551Allosteric activator fructose 2,6-bisphosphate; shared with dimeric partnerUniRule annotation
Binding sitei735 – 7351Allosteric activator fructose 2,6-bisphosphateUniRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi88 – 892ATPUniRule annotation
Nucleotide bindingi118 – 1214ATPUniRule annotation

GO - Molecular functioni

  1. 6-phosphofructokinase activity Source: UniProtKB
  2. ATP binding Source: UniProtKB-KW
  3. fructose binding Source: Ensembl
  4. metal ion binding Source: UniProtKB-KW
  5. phosphofructokinase activity Source: MGI
  6. protein homodimerization activity Source: MGI

GO - Biological processi

  1. carbohydrate phosphorylation Source: GOC
  2. fructose 6-phosphate metabolic process Source: InterPro
  3. glucose homeostasis Source: MGI
  4. glycolytic process Source: MGI
  5. glycolytic process through fructose-6-phosphate Source: MGI
  6. muscle cell cellular homeostasis Source: Ensembl
  7. positive regulation of insulin secretion Source: MGI
  8. protein oligomerization Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Biological processi

Glycolysis

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

SABIO-RKP47857.
UniPathwayiUPA00109; UER00182.

Names & Taxonomyi

Protein namesi
Recommended name:
ATP-dependent 6-phosphofructokinase, muscle typeUniRule annotation (EC:2.7.1.11UniRule annotation)
Short name:
ATP-PFKUniRule annotation
Short name:
PFK-M
Alternative name(s):
6-phosphofructokinase type A
Phosphofructo-1-kinase isozyme A
Short name:
PFK-A
PhosphohexokinaseUniRule annotation
Gene namesi
Name:Pfkm
Synonyms:Pfk-m, Pfka
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 15

Organism-specific databases

MGIiMGI:97548. Pfkm.

Subcellular locationi

Cytoplasm UniRule annotation
Isoform 2 : Cell projectionciliumflagellum 1 Publication
Note: Principal piece region of the sperm flagellum.1 Publication
Isoform 3 : Cell projectionciliumflagellum 1 Publication
Note: Principal piece region of the sperm flagellum.1 Publication

GO - Cellular componenti

  1. apical plasma membrane Source: Ensembl
  2. cytosol Source: MGI
  3. extracellular vesicular exosome Source: Ensembl
  4. sperm principal piece Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Flagellum

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 780779ATP-dependent 6-phosphofructokinase, muscle typePRO_0000112018Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylthreonineBy similarity
Glycosylationi530 – 5301O-linked (GlcNAc)By similarity
Modified residuei667 – 6671PhosphoserineBy similarity
Modified residuei775 – 7751PhosphoserineBy similarity

Post-translational modificationi

GlcNAcylation decreases enzyme activity.By similarity

Keywords - PTMi

Acetylation, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP47857.
PaxDbiP47857.
PRIDEiP47857.

PTM databases

PhosphoSiteiP47857.

Miscellaneous databases

PMAP-CutDBP47857.

Expressioni

Tissue specificityi

Isoform 1 is expressed in skeletal muscle (at protein level). Isoform 2 and isoform 3 are testis-specific and are detected in quiescent sperm (at protein level). They are first detected in the cytoplasm of round spermatids and subsequently in the flagellum of elongated spermatids extending into the seminiferous tubule lumen (at protein level). Isoform 2 is expressed at higher level than isoform 3 in testis.1 Publication

Developmental stagei

Isoform 2 and isoform 3 are first seen on postnatal day 16 corresponding to the age when midpachytene spermatocytes are present in the synchronous first wave of spermatogenesis. Isoform 2 and isoform 3 levels increase substantially between days 14 and 18 and continue to increase to age 30 days of neonatal testis development.1 Publication

Gene expression databases

BgeeiP47857.
CleanExiMM_PFKM.
ExpressionAtlasiP47857. baseline and differential.
GenevestigatoriP47857.

Interactioni

Subunit structurei

Homo- and heterotetramers. Isoform 2 and isoform 3 interact (via N-terminal testis-specific region) with GSTM5. Isoform 2 and isoform 3 interact (via C-terminus) with HK1 (via N-terminal spermatogenic cell-specific region).1 Publication

Protein-protein interaction databases

BioGridi202125. 2 interactions.
IntActiP47857. 4 interactions.
MINTiMINT-1869891.

Structurei

3D structure databases

ProteinModelPortaliP47857.
SMRiP47857. Positions 8-755.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni2 – 390389N-terminal catalytic PFK domain 1Add
BLAST
Regioni164 – 1663Substrate bindingUniRule annotation
Regioni208 – 2103Substrate bindingUniRule annotation
Regioni298 – 3014Substrate bindingUniRule annotation
Regioni391 – 40111Interdomain linkerAdd
BLAST
Regioni402 – 780379C-terminal regulatory PFK domain 2Add
BLAST
Regioni528 – 5325Allosteric activator fructose 2,6-bisphosphate bindingUniRule annotation
Regioni573 – 5753Allosteric activator fructose 2,6-bisphosphate bindingUniRule annotation
Regioni661 – 6644Allosteric activator fructose 2,6-bisphosphate bindingUniRule annotation

Sequence similaritiesi

Belongs to the phosphofructokinase type A (PFKA) family. ATP-dependent PFK group I subfamily. Eukaryotic two domain clade "E" sub-subfamily.UniRule annotation

Phylogenomic databases

eggNOGiCOG0205.
GeneTreeiENSGT00390000013209.
HOGENOMiHOG000200154.
HOVERGENiHBG000976.
InParanoidiP47857.
KOiK00850.
OMAiVYHMASK.
OrthoDBiEOG7ZSHV5.
PhylomeDBiP47857.
TreeFamiTF300411.

Family and domain databases

HAMAPiMF_03184. Phosphofructokinase_I_E.
InterProiIPR009161. 6-phosphofructokinase_euk.
IPR022953. Phosphofructokinase.
IPR015912. Phosphofructokinase_CS.
IPR000023. Phosphofructokinase_dom.
[Graphical view]
PfamiPF00365. PFK. 2 hits.
[Graphical view]
PIRSFiPIRSF000533. ATP_PFK_euk. 1 hit.
PRINTSiPR00476. PHFRCTKINASE.
SUPFAMiSSF53784. SSF53784. 2 hits.
TIGRFAMsiTIGR02478. 6PF1K_euk. 1 hit.
PROSITEiPS00433. PHOSPHOFRUCTOKINASE. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P47857-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTHEEHHAAK TLGIGKAIAV LTSGGDAQGM NAAVRAVVRV GIFTGARVFF
60 70 80 90 100
VHEGYQGLVD GGEHIREATW ESVSMMLQLG GTVIGSARCK DFREREGRLR
110 120 130 140 150
AAHNLVKRGI TNLCVIGGDG SLTGADTFRS EWSDLLNDLQ KDGKITAEEA
160 170 180 190 200
TKSSYLNIVG LVGSIDNDFC GTDMTIGTDS ALHRIVEIVD AITTTAQSHQ
210 220 230 240 250
RTFVLEVMGR HCGYLALVTS LSCGADWVFI PECPPDDDWE EHLCRRLSET
260 270 280 290 300
RTRGSRLNII IVAEGAIDKN GKPITSEDIK NLVVKRLGYD TRVTVLGHVQ
310 320 330 340 350
RGGTPSAFDR ILGSRMGVEA VMALLEGTPD TPACVVSLSG NQAVRLPLME
360 370 380 390 400
CVQVTKDVTK AMDEKRFDEA IKLRGRSFMN NWEVYKLLAH VRPPVSKGGL
410 420 430 440 450
HTVAVMNVGA PAAGMNAAVR STVRIGLIQG NRVLVVHDGF EGLAKGQIEE
460 470 480 490 500
AGWSYVGGWT GQGGSKLGTK RTLPKKNLEQ ISANITKFNI QGLVIIGGFE
510 520 530 540 550
AYTGGLELME GRKQFDELCI PFVVIPATVS NNVPGSDFSI GADTALNTIC
560 570 580 590 600
TTCDRIKQSA AGTKRRVFII ETMGGYCGYL ATMAGLAAGA DAAYIFEEPF
610 620 630 640 650
TIRDLQVNVE HLVQKMKTTV KRGLVLRNEK CNENYTTDFI FNLYSEEGKG
660 670 680 690 700
IFDSRKNVLG HMQQGGSPTP FDRNFATKMG AKAMNWMSGK IKESYRNGRI
710 720 730 740 750
FANTPDSGCV LGMRKRALVF QPVTELKDQT DFEHRIPKEQ WWLKLRPILK
760 770 780
ILAKYEIDLD TSDHAHLEHI SRKRSGEAAV
Length:780
Mass (Da):85,269
Last modified:January 23, 2007 - v3
Checksum:i7917C7AC108B25C7
GO
Isoform 2 (identifier: P47857-2) [UniParc]FASTAAdd to Basket

Also known as: Pfkms_V41 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRREEFQLRFFMCVIESRQVVRTTQSTAGEASTSNMTIPESKADDQWRLDGMDDDPSTVGPVSIPDTEWIM

Show »
Length:850
Mass (Da):93,248
Checksum:i054BC0B487ACDE63
GO
Isoform 3 (identifier: P47857-3) [UniParc]FASTAAdd to Basket

Also known as: Pfkms_V31 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEEKLTCSFK...VSIPDTEWIM

Show »
Length:931
Mass (Da):102,384
Checksum:iDB9962A8A731FC77
GO

Sequence cautioni

The sequence AK138788 differs from that shown. Reason: Intron retention

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MRREEFQLRFFMCVIESRQV VRTTQSTAGEASTSNMTIPE SKADDQWRLDGMDDDPSTVG PVSIPDTEWIM in isoform 2. 1 PublicationVSP_057079
Alternative sequencei1 – 11M → MEEKLTCSFKLLTELLNLIT PLAQALFGKRLQNSILDPGD CLSEFTLEERKASGICQPHL FSKHKEINLFLQGILTCYEV AMRREEFQLRFFMCVIESRQ VVRTTQSTAGEASTSNMTIP ESKADDQWRLDGMDDDPSTV GPVSIPDTEWIM in isoform 3. 1 PublicationVSP_057080

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF249894 mRNA. Translation: AAF63762.1.
AK002711 mRNA. Translation: BAB22303.1.
AK049773 mRNA. Translation: BAC33913.1.
AK138788 mRNA. No translation available.
D21864 Genomic DNA. Translation: BAA21892.1.
D21865 mRNA. Translation: BAA21012.1.
GQ428204 mRNA. Translation: ACU65458.1.
GQ428205 mRNA. Translation: ACU65459.1.
GQ428206 mRNA. Translation: ACU65460.1.
CCDSiCCDS27786.1.
PIRiS53317.
RefSeqiNP_001156959.1. NM_001163487.1.
NP_001156960.1. NM_001163488.1.
NP_067489.3. NM_021514.4.
XP_006520665.1. XM_006520602.1.
UniGeneiMm.272582.

Genome annotation databases

EnsembliENSMUST00000051226; ENSMUSP00000059801; ENSMUSG00000033065.
ENSMUST00000163507; ENSMUSP00000132803; ENSMUSG00000033065.
GeneIDi18642.
KEGGimmu:18642.
UCSCiuc007xlv.2. mouse.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF249894 mRNA. Translation: AAF63762.1 .
AK002711 mRNA. Translation: BAB22303.1 .
AK049773 mRNA. Translation: BAC33913.1 .
AK138788 mRNA. No translation available.
D21864 Genomic DNA. Translation: BAA21892.1 .
D21865 mRNA. Translation: BAA21012.1 .
GQ428204 mRNA. Translation: ACU65458.1 .
GQ428205 mRNA. Translation: ACU65459.1 .
GQ428206 mRNA. Translation: ACU65460.1 .
CCDSi CCDS27786.1.
PIRi S53317.
RefSeqi NP_001156959.1. NM_001163487.1.
NP_001156960.1. NM_001163488.1.
NP_067489.3. NM_021514.4.
XP_006520665.1. XM_006520602.1.
UniGenei Mm.272582.

3D structure databases

ProteinModelPortali P47857.
SMRi P47857. Positions 8-755.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 202125. 2 interactions.
IntActi P47857. 4 interactions.
MINTi MINT-1869891.

PTM databases

PhosphoSitei P47857.

Proteomic databases

MaxQBi P47857.
PaxDbi P47857.
PRIDEi P47857.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000051226 ; ENSMUSP00000059801 ; ENSMUSG00000033065 .
ENSMUST00000163507 ; ENSMUSP00000132803 ; ENSMUSG00000033065 .
GeneIDi 18642.
KEGGi mmu:18642.
UCSCi uc007xlv.2. mouse.

Organism-specific databases

CTDi 5213.
MGIi MGI:97548. Pfkm.

Phylogenomic databases

eggNOGi COG0205.
GeneTreei ENSGT00390000013209.
HOGENOMi HOG000200154.
HOVERGENi HBG000976.
InParanoidi P47857.
KOi K00850.
OMAi VYHMASK.
OrthoDBi EOG7ZSHV5.
PhylomeDBi P47857.
TreeFami TF300411.

Enzyme and pathway databases

UniPathwayi UPA00109 ; UER00182 .
SABIO-RK P47857.

Miscellaneous databases

ChiTaRSi PFKM. mouse.
NextBioi 294630.
PMAP-CutDB P47857.
PROi P47857.
SOURCEi Search...

Gene expression databases

Bgeei P47857.
CleanExi MM_PFKM.
ExpressionAtlasi P47857. baseline and differential.
Genevestigatori P47857.

Family and domain databases

HAMAPi MF_03184. Phosphofructokinase_I_E.
InterProi IPR009161. 6-phosphofructokinase_euk.
IPR022953. Phosphofructokinase.
IPR015912. Phosphofructokinase_CS.
IPR000023. Phosphofructokinase_dom.
[Graphical view ]
Pfami PF00365. PFK. 2 hits.
[Graphical view ]
PIRSFi PIRSF000533. ATP_PFK_euk. 1 hit.
PRINTSi PR00476. PHFRCTKINASE.
SUPFAMi SSF53784. SSF53784. 2 hits.
TIGRFAMsi TIGR02478. 6PF1K_euk. 1 hit.
PROSITEi PS00433. PHOSPHOFRUCTOKINASE. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Genomic organization, 5'flanking region and tissue-specific expression of mouse phosphofructokinase C gene."
    Gunasekera D., Kemp R.G.
    Gene 260:103-112(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: Swiss.
    Tissue: Brain.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Strain: C57BL/6J.
    Tissue: Kidney, Spinal cord and ThymusImported.
  3. "Expression of mouse phosphofructokinase-M gene alternative transcripts: evidence for the conserved two-promoter system."
    Nakajima H., Noguchi T., Hamaguchi T., Tomita K., Hanafusa T., Kono N., Tanaka T., Kuwajima M., Matsuzawa Y.
    Biochem. J. 303:449-453(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-213 (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 259-345.
    Strain: ICR.
  4. "Molecular complex of three testis-specific isozymes associated with the mouse sperm fibrous sheath: hexokinase 1, phosphofructokinase M, and glutathione S-transferase mu class 5."
    Nakamura N., Mori C., Eddy E.M.
    Biol. Reprod. 82:504-515(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH GSTM5 AND HK1, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: C57BL/6Imported.
  5. Lubec G., Kang S.U.
    Submitted (APR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 367-374, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: C57BL/6.
    Tissue: Brain.

Entry informationi

Entry nameiPFKAM_MOUSE
AccessioniPrimary (citable) accession number: P47857
Secondary accession number(s): C8CMN5
, C8CMN6, C8CMN7, O35513, Q543L1, Q9JK94
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: January 23, 2007
Last modified: October 29, 2014
This is version 142 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Allosteric enzyme, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3