Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P47757

- CAPZB_MOUSE

UniProt

P47757 - CAPZB_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

F-actin-capping protein subunit beta

Gene

Capzb

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Isoform 3 may play a role in spermatogenesis. Alternatively, may play a role in later maturation steps such as capacitation and fertilization which involve changes of membrane domains. Plays a role in the regulation of cell morphology and cytoskeletal organization (By similarity).By similarity

GO - Molecular functioni

  1. beta-tubulin binding Source: MGI

GO - Biological processi

  1. actin cytoskeleton organization Source: InterPro
  2. barbed-end actin filament capping Source: MGI
  3. cell projection organization Source: MGI
  4. cytoskeleton organization Source: UniProtKB
  5. lamellipodium assembly Source: MGI
  6. muscle fiber development Source: MGI
  7. negative regulation of microtubule polymerization Source: MGI
  8. neuron projection development Source: MGI
  9. regulation of cell morphogenesis Source: UniProtKB
  10. regulation of protein kinase C signaling Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Actin capping

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

ReactomeiREACT_198649. Factors involved in megakaryocyte development and platelet production.

Names & Taxonomyi

Protein namesi
Recommended name:
F-actin-capping protein subunit beta
Alternative name(s):
CapZ beta
Gene namesi
Name:Capzb
Synonyms:Cappb1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 4

Organism-specific databases

MGIiMGI:104652. Capzb.

Subcellular locationi

Cytoplasmcytoskeleton By similarity
Isoform 1 : CytoplasmmyofibrilsarcomereZ line By similarity. Cytoplasmmyofibrilsarcomere By similarity
Note: In cardiac muscle, isoform 1 is located at Z-disks of sarcomeres while isoform 2 is enriched at intercalated disks.By similarity
Isoform 3 : Cytoplasmcytoskeletonperinuclear thecacalyx By similarity
Note: Isoform 3 is located to sperm head cytoskeletal structure tightly associated to the nucleus (By similarity). Isoform 3 colocalizes with the alpha subunit in testicular sperm and to the acrosome in elongating and condensing spermatids.By similarity

GO - Cellular componenti

  1. cortical cytoskeleton Source: MGI
  2. extracellular vesicular exosome Source: Ensembl
  3. F-actin capping protein complex Source: MGI
  4. intercalated disc Source: MGI
  5. lamellipodium Source: MGI
  6. membrane Source: MGI
  7. WASH complex Source: UniProtKB
  8. Z disc Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 277276F-actin-capping protein subunit betaPRO_0000204635Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserineBy similarity
Modified residuei235 – 2351N6-acetyllysine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiP47757.
PaxDbiP47757.
PRIDEiP47757.

2D gel databases

REPRODUCTION-2DPAGEP47757.
UCD-2DPAGEP47757.

PTM databases

PhosphoSiteiP47757.

Expressioni

Tissue specificityi

Isoform 3 is testis-specific and is present in round spermatids, but not in pachytene spermatocytes or Sertoli cells.1 Publication

Developmental stagei

Isoform 3 is first detected in testis 22 days after birth, coinciding with the first wave of round spermatid development. It is also detected on 30 and 60 days after birth.1 Publication

Gene expression databases

BgeeiP47757.
ExpressionAtlasiP47757. baseline and differential.
GenevestigatoriP47757.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. Interacts with ARHGAP17 and RCSD1/CAPZIP. Component of the WASH complex, composed of F-actin-capping protein subunit alpha (CAPZA1, CAPZA2 or CAPZA3), F-actin-capping protein subunit beta (CAPZB), WASH1, FAM21, KIAA1033, KIAA0196 and CCDC53 (By similarity). Isoform 2 also is a component of dynactin complex from brain, which contains the actin-related protein ARP1.By similarity

Protein-protein interaction databases

BioGridi198480. 9 interactions.
DIPiDIP-31383N.
IntActiP47757. 7 interactions.
MINTiMINT-1864831.
STRINGi10090.ENSMUSP00000030518.

Structurei

3D structure databases

ProteinModelPortaliP47757.
SMRiP47757. Positions 2-244.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG291067.
GeneTreeiENSGT00390000017957.
HOGENOMiHOG000041208.
HOVERGENiHBG050789.
InParanoidiP47757.
KOiK10365.
OMAiLMSESIL.
OrthoDBiEOG7NPFTR.
PhylomeDBiP47757.
TreeFamiTF105732.

Family and domain databases

InterProiIPR001698. CapZ_beta.
IPR019771. F-actin_capping_bsu_CS.
[Graphical view]
PANTHERiPTHR10619. PTHR10619. 1 hit.
PfamiPF01115. F_actin_cap_B. 1 hit.
[Graphical view]
PRINTSiPR00192. FACTINCAPB.
PROSITEiPS00231. F_ACTIN_CAPPING_BETA. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P47757-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDQQLDCAL DLMRRLPPQQ IEKNLSDLID LVPSLCEDLL SSVDQPLKIA
60 70 80 90 100
RDKVVGKDYL LCDYNRDGDS YRSPWSNKYD PPLEDGAMPS ARLRKLEVEA
110 120 130 140 150
NNAFDQYRDL YFEGGVSSVY LWDLDHGFAG VILIKKAGDG SKKIKGCWDS
160 170 180 190 200
IHVVEVQEKS SGRTAHYKLT STVMLWLQTN KSGSGTMNLG GSLTRQMEKD
210 220 230 240 250
ETVSDCSPHI ANIGRLVEDM ENKIRSTLNE IYFGKTKDIV NGLRSLDAIP
260 270
DNHKFKQLQR ELSQVLTQRQ VYIQPDN
Length:277
Mass (Da):31,345
Last modified:January 23, 2007 - v3
Checksum:iC4409B1F9E014033
GO
Isoform 2 (identifier: P47757-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     246-277: LDAIPDNHKFKQLQRELSQVLTQRQVYIQPDN → VQTFADKSKQEALKNDLVEALKRKQQC

Show »
Length:272
Mass (Da):30,629
Checksum:iE6466A68B1254FD0
GO
Isoform 3 (identifier: P47757-4) [UniParc]FASTAAdd to Basket

Also known as: Capzb3

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHPSRRSLPFPLNCQLVRVGTADYGGASEQ
     246-277: LDAIPDNHKFKQLQRELSQVLTQRQVYIQPDN → VQTFADKSKQEALKNDLVEALKRKQQC

Show »
Length:301
Mass (Da):33,767
Checksum:i8E3F2CFD4D06B2F0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MHPSRRSLPFPLNCQLVRVG TADYGGASEQ in isoform 3. 1 PublicationVSP_046517
Alternative sequencei246 – 27732LDAIP…IQPDN → VQTFADKSKQEALKNDLVEA LKRKQQC in isoform 2 and isoform 3. 2 PublicationsVSP_000768Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U10406 mRNA. Translation: AAA52226.1.
U10407 mRNA. Translation: AAA52227.1.
FJ692320 mRNA. Translation: ACN43612.1.
AL807811 Genomic DNA. No translation available.
CCDSiCCDS18841.1. [P47757-2]
CCDS18842.1. [P47757-1]
CCDS71503.1. [P47757-4]
PIRiB54819.
RefSeqiNP_001032850.1. NM_001037761.2. [P47757-1]
NP_001258334.1. NM_001271405.1. [P47757-4]
NP_033928.1. NM_009798.4. [P47757-2]
UniGeneiMm.2945.

Genome annotation databases

EnsembliENSMUST00000030518; ENSMUSP00000030518; ENSMUSG00000028745. [P47757-4]
ENSMUST00000102507; ENSMUSP00000099565; ENSMUSG00000028745. [P47757-1]
ENSMUST00000102508; ENSMUSP00000099566; ENSMUSG00000028745. [P47757-2]
GeneIDi12345.
KEGGimmu:12345.
UCSCiuc008vlv.1. mouse. [P47757-1]
uc012dnq.1. mouse.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U10406 mRNA. Translation: AAA52226.1 .
U10407 mRNA. Translation: AAA52227.1 .
FJ692320 mRNA. Translation: ACN43612.1 .
AL807811 Genomic DNA. No translation available.
CCDSi CCDS18841.1. [P47757-2 ]
CCDS18842.1. [P47757-1 ]
CCDS71503.1. [P47757-4 ]
PIRi B54819.
RefSeqi NP_001032850.1. NM_001037761.2. [P47757-1 ]
NP_001258334.1. NM_001271405.1. [P47757-4 ]
NP_033928.1. NM_009798.4. [P47757-2 ]
UniGenei Mm.2945.

3D structure databases

ProteinModelPortali P47757.
SMRi P47757. Positions 2-244.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 198480. 9 interactions.
DIPi DIP-31383N.
IntActi P47757. 7 interactions.
MINTi MINT-1864831.
STRINGi 10090.ENSMUSP00000030518.

PTM databases

PhosphoSitei P47757.

2D gel databases

REPRODUCTION-2DPAGE P47757.
UCD-2DPAGE P47757.

Proteomic databases

MaxQBi P47757.
PaxDbi P47757.
PRIDEi P47757.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000030518 ; ENSMUSP00000030518 ; ENSMUSG00000028745 . [P47757-4 ]
ENSMUST00000102507 ; ENSMUSP00000099565 ; ENSMUSG00000028745 . [P47757-1 ]
ENSMUST00000102508 ; ENSMUSP00000099566 ; ENSMUSG00000028745 . [P47757-2 ]
GeneIDi 12345.
KEGGi mmu:12345.
UCSCi uc008vlv.1. mouse. [P47757-1 ]
uc012dnq.1. mouse.

Organism-specific databases

CTDi 832.
MGIi MGI:104652. Capzb.

Phylogenomic databases

eggNOGi NOG291067.
GeneTreei ENSGT00390000017957.
HOGENOMi HOG000041208.
HOVERGENi HBG050789.
InParanoidi P47757.
KOi K10365.
OMAi LMSESIL.
OrthoDBi EOG7NPFTR.
PhylomeDBi P47757.
TreeFami TF105732.

Enzyme and pathway databases

Reactomei REACT_198649. Factors involved in megakaryocyte development and platelet production.

Miscellaneous databases

ChiTaRSi CAPZB. mouse.
NextBioi 280980.
PROi P47757.
SOURCEi Search...

Gene expression databases

Bgeei P47757.
ExpressionAtlasi P47757. baseline and differential.
Genevestigatori P47757.

Family and domain databases

InterProi IPR001698. CapZ_beta.
IPR019771. F-actin_capping_bsu_CS.
[Graphical view ]
PANTHERi PTHR10619. PTHR10619. 1 hit.
Pfami PF01115. F_actin_cap_B. 1 hit.
[Graphical view ]
PRINTSi PR00192. FACTINCAPB.
PROSITEi PS00231. F_ACTIN_CAPPING_BETA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Differential localization and sequence analysis of capping protein beta-subunit isoforms of vertebrates."
    Schafer D.A., Korshunova Y.O., Schroer T.A., Cooper J.A.
    J. Cell Biol. 127:453-465(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Skeletal muscle.
  2. "A missense mutation in the Capza3 gene and disruption of F-actin organization in spermatids of repro32 infertile male mice."
    Geyer C.B., Inselman A.L., Sunman J.A., Bornstein S., Handel M.A., Eddy E.M.
    Dev. Biol. 330:142-152(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: CD-1.
    Tissue: Testis.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. Lubec G., Klug S., Yang J.W., Zigmond M.
    Submitted (JUL-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 79-92 AND 169-181, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Brain and Hippocampus.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  6. "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways."
    Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.
    Mol. Cell 50:919-930(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-235, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.

Entry informationi

Entry nameiCAPZB_MOUSE
AccessioniPrimary (citable) accession number: P47757
Secondary accession number(s): A2AMV7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: January 23, 2007
Last modified: October 29, 2014
This is version 128 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3