Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-actin-capping protein subunit beta

Gene

CAPZB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.1 Publication

GO - Molecular functioni

  • actin binding Source: UniProtKB
  • actin filament binding Source: GO_Central
  • cadherin binding Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionActin capping, Actin-binding

Enzyme and pathway databases

ReactomeiR-HSA-2132295 MHC class II antigen presentation
R-HSA-3371497 HSP90 chaperone cycle for steroid hormone receptors (SHR)
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic
R-HSA-983231 Factors involved in megakaryocyte development and platelet production

Names & Taxonomyi

Protein namesi
Recommended name:
F-actin-capping protein subunit beta
Alternative name(s):
CapZ beta
Gene namesi
Name:CAPZB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000077549.17
HGNCiHGNC:1491 CAPZB
MIMi601572 gene
neXtProtiNX_P47756

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi832
OpenTargetsiENSG00000077549
PharmGKBiPA26072

Polymorphism and mutation databases

DMDMi13124696

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00002046342 – 277F-actin-capping protein subunit betaAdd BLAST276

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1 Publication1
Modified residuei2PhosphoserineCombined sources1
Modified residuei235N6-acetyllysineCombined sources1
Modified residuei263PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP47756
PaxDbiP47756
PeptideAtlasiP47756
PRIDEiP47756
TopDownProteomicsiP47756-2 [P47756-2]

2D gel databases

DOSAC-COBS-2DPAGEiP47756
OGPiP47756
REPRODUCTION-2DPAGEiIPI00026185
SWISS-2DPAGEiP47756

PTM databases

CarbonylDBiP47756
iPTMnetiP47756
PhosphoSitePlusiP47756
SwissPalmiP47756

Expressioni

Gene expression databases

BgeeiENSG00000077549
CleanExiHS_CAPZB
ExpressionAtlasiP47756 baseline and differential
GenevisibleiP47756 HS

Organism-specific databases

HPAiHPA031531
HPA056066

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. Interacts with ARHGAP17 (PubMed:16678097). Interaction with RCSD1/CAPZIP (PubMed:15850461). Component of the WASH complex, composed of F-actin-capping protein subunit alpha (CAPZA1, CAPZA2 or CAPZA3), F-actin-capping protein subunit beta (CAPZB), WASH (WASHC1, WASH2P, WASH3P, WASH4P, WASH5P or WASH6P), WASHC2 (WASHC2A or WASHC2C), WASHC3, WASHC4 and WASHC5 (PubMed:19922875). Interacts with ACTG1 (PubMed:28493397).4 Publications

GO - Molecular functioni

  • actin binding Source: UniProtKB
  • actin filament binding Source: GO_Central
  • cadherin binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi107282, 159 interactors
CORUMiP47756
IntActiP47756, 72 interactors
MINTiP47756
STRINGi9606.ENSP00000264202

Structurei

3D structure databases

ProteinModelPortaliP47756
SMRiP47756
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3174 Eukaryota
ENOG410XQYD LUCA
GeneTreeiENSGT00390000017957
HOGENOMiHOG000041208
HOVERGENiHBG050789
InParanoidiP47756
KOiK10365
PhylomeDBiP47756
TreeFamiTF105732

Family and domain databases

InterProiView protein in InterPro
IPR037282 CapZ_alpha/beta
IPR001698 CAPZB
IPR019771 F-actin_capping_bsu_CS
PANTHERiPTHR10619 PTHR10619, 1 hit
PfamiView protein in Pfam
PF01115 F_actin_cap_B, 1 hit
PRINTSiPR00192 FACTINCAPB
SUPFAMiSSF90096 SSF90096, 1 hit
PROSITEiView protein in PROSITE
PS00231 F_ACTIN_CAPPING_BETA, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P47756-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDQQLDCAL DLMRRLPPQQ IEKNLSDLID LVPSLCEDLL SSVDQPLKIA
60 70 80 90 100
RDKVVGKDYL LCDYNRDGDS YRSPWSNKYD PPLEDGAMPS ARLRKLEVEA
110 120 130 140 150
NNAFDQYRDL YFEGGVSSVY LWDLDHGFAG VILIKKAGDG SKKIKGCWDS
160 170 180 190 200
IHVVEVQEKS SGRTAHYKLT STVMLWLQTN KSGSGTMNLG GSLTRQMEKD
210 220 230 240 250
ETVSDCSPHI ANIGRLVEDM ENKIRSTLNE IYFGKTKDIV NGLRSIDAIP
260 270
DNQKFKQLQR ELSQVLTQRQ IYIQPDN
Length:277
Mass (Da):31,350
Last modified:January 23, 2007 - v4
Checksum:iABA1621F9E0152A6
GO
Isoform 2 (identifier: P47756-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     246-277: IDAIPDNQKFKQLQRELSQVLTQRQIYIQPDN → VQTFADKSKQEALKNDLVEALKRKQQC

Show »
Length:272
Mass (Da):30,629
Checksum:iE6466A68B1254FD0
GO
Isoform 3 (identifier: P47756-3)
Sequence is not available
Length:
Mass (Da):

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000767246 – 277IDAIP…IQPDN → VQTFADKSKQEALKNDLVEA LKRKQQC in isoform 2. 3 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U03271 mRNA Translation: AAA87395.1
BT019470 mRNA Translation: AAV38277.1
BT019471 mRNA Translation: AAV38278.1
AL035413 Genomic DNA No translation available.
AL359199 Genomic DNA No translation available.
AL445163 Genomic DNA No translation available.
CH471134 Genomic DNA Translation: EAW94890.1
BC024601 mRNA Translation: AAH24601.1
BC107752 mRNA Translation: AAI07753.1
BC109241 mRNA Translation: AAI09242.1
BC109242 mRNA Translation: AAI09243.1
CCDSiCCDS41277.1 [P47756-2]
CCDS55579.1 [P47756-1]
RefSeqiNP_001193469.1, NM_001206540.2 [P47756-1]
NP_001269091.1, NM_001282162.1
NP_004921.1, NM_004930.4 [P47756-2]
UniGeneiHs.432760

Genome annotation databases

EnsembliENST00000264202; ENSP00000264202; ENSG00000077549 [P47756-2]
ENST00000375142; ENSP00000364284; ENSG00000077549 [P47756-1]
GeneIDi832
KEGGihsa:832
UCSCiuc001bce.5 human [P47756-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCAPZB_HUMAN
AccessioniPrimary (citable) accession number: P47756
Secondary accession number(s): Q32Q68
, Q5U0L4, Q8TB49, Q9NUC4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: January 23, 2007
Last modified: May 23, 2018
This is version 181 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health