P47756 (CAPZB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 128.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: F-actin-capping protein subunit beta Alternative name(s): CapZ beta | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 277 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization. Ref.12 |
| Subunit structure | Heterodimer of an alpha and a beta subunit. Interacts with ARHGAP17 and RCSD1/CAPZIP. Component of the WASH complex, composed of F-actin-capping protein subunit alpha (CAPZA1, CAPZA2 or CAPZA3), F-actin-capping protein subunit beta (CAPZB), WASH (WASH1, WASH2P, WASH3P, WASH4P, WASH5P or WASH6P), FAM21 (FAM21A, FAM21B or FAM21C), KIAA1033, KIAA0196 and CCDC53. Ref.8 Ref.9 Ref.10 |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. |
| Sequence similarities | Belongs to the F-actin-capping protein beta subunit family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P47756-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P47756-2) The sequence of this isoform differs from the canonical sequence as follows: 246-277: IDAIPDNQKFKQLQRELSQVLTQRQIYIQPDN → VQTFADKSKQEALKNDLVEALKRKQQC | ||||||
| Isoform 3 (identifier: P47756-3) The sequence of this isoform is not available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.6 | ||||||
| Chain | 2 – 277 | 276 | F-actin-capping protein subunit beta | PRO_0000204634 | |||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylserine Ref.6 | ||||||
| Modified residue | 182 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 235 | 1 | N6-acetyllysine Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 246 – 277 | 32 | IDAIP…IQPDN → VQTFADKSKQEALKNDLVEA LKRKQQC in isoform 2. | VSP_000767 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence analysis and chromosomal localization of human Cap Z. Conserved residues within the actin-binding domain may link Cap Z to gelsolin/severin and profilin protein families." Barron-Casella E.A., Torres M.A., Scherer S.W., Heng H.H.Q., Tsui L.-C., Casella J.F. J. Biol. Chem. 270:21472-21479(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Retina. |
| [2] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Ovary. |
| [6] | "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-14, ACETYLATION AT SER-2. Tissue: Platelet. |
| [7] | Lubec G., Afjehi-Sadat L. Submitted (MAR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 95-108, MASS SPECTROMETRY. Tissue: Brain and Cajal-Retzius cell. |
| [8] | "The phosphorylation of CapZ-interacting protein (CapZIP) by stress-activated protein kinases triggers its dissociation from CapZ." Eyers C.E., McNeill H., Knebel A., Morrice N., Arthur S.J.C., Cuenda A., Cohen P. Biochem. J. 389:127-135(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RCSD1/CAPZIP, IDENTIFICATION BY MASS SPECTROMETRY. |
| [9] | "A Rich1/Amot complex regulates the Cdc42 GTPase and apical-polarity proteins in epithelial cells." Wells C.D., Fawcett J.P., Traweger A., Yamanaka Y., Goudreault M., Elder K., Kulkarni S., Gish G., Virag C., Lim C., Colwill K., Starostine A., Metalnikov P., Pawson T. Cell 125:535-548(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ARHGAP17. |
| [10] | "The Arp2/3 activator WASH controls the fission of endosomes through a large multiprotein complex." Derivery E., Sousa C., Gautier J.J., Lombard B., Loew D., Gautreau A. Dev. Cell 17:712-723(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE WASH COMPLEX. |
| [11] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-235, MASS SPECTROMETRY. |
| [12] | "Identification and characterization of a set of conserved and new regulators of cytoskeletal organisation, cell morphology and migration." Bai S.W., Herrera-Abreu M.T., Rohn J.L., Racine V., Tajadura V., Suryavanshi N., Bechtel S., Wiemann S., Baum B., Ridley A.J. BMC Biol. 9:54-54(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U03271 mRNA. Translation: AAA87395.1. BT019470 mRNA. Translation: AAV38277.1. BT019471 mRNA. Translation: AAV38278.1. AL035413, AL359199, AL445163 Genomic DNA. Translation: CAI22231.1. AL359199, AL035413, AL445163 Genomic DNA. Translation: CAH72124.1. AL445163, AL035413, AL359199 Genomic DNA. Translation: CAH71392.1. CH471134 Genomic DNA. Translation: EAW94890.1. BC024601 mRNA. Translation: AAH24601.1. BC107752 mRNA. Translation: AAI07753.1. BC109241 mRNA. Translation: AAI09242.1. BC109242 mRNA. Translation: AAI09243.1. |
| IPI | IPI00026185. IPI00642256. |
| RefSeq | NP_001193469.1. NM_001206540.1. NP_004921.1. NM_004930.3. |
| UniGene | Hs.432760. |
3D structure databases | |
| ProteinModelPortal | P47756. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P47756. 15 interactions. |
| MINT | MINT-254051. |
| STRING | 9606.ENSP00000364287. |
PTM databases | |
| PhosphoSite | P47756. |
Polymorphism databases | |
| DMDM | 13124696. |
2D gel databases | |
| DOSAC-COBS-2DPAGE | P47756. |
| OGP | P47756. |
| REPRODUCTION-2DPAGE | IPI00026185. |
| SWISS-2DPAGE | P47756. |
Proteomic databases | |
| PaxDb | P47756. |
| PRIDE | P47756. |
Protocols and materials databases | |
| DNASU | 832. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000264202; ENSP00000264202; ENSG00000077549. ENST00000375142; ENSP00000364284; ENSG00000077549. ENST00000401084; ENSP00000383862; ENSG00000077549. |
| GeneID | 832. |
| KEGG | hsa:832. |
| UCSC | uc001bce.3. human. uc021ohr.1. human. |
Organism-specific databases | |
| CTD | 832. |
| GeneCards | GC01M019665. |
| HGNC | HGNC:1491. CAPZB. |
| HPA | HPA031531. |
| MIM | 601572. gene. |
| neXtProt | NX_P47756. |
| PharmGKB | PA26072. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG291067. |
| HOGENOM | HOG000041208. |
| HOVERGEN | HBG050789. |
| KO | K10365. |
| OMA | NLLQEVY. |
Enzyme and pathway databases | |
| Reactome | REACT_604. Hemostasis. |
Gene expression databases | |
| ArrayExpress | P47756. |
| Bgee | P47756. |
| CleanEx | HS_CAPZB. |
| Genevestigator | P47756. |
| GermOnline | ENSG00000077549. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR019771. F-actin_capping_bsu_CS. IPR001698. WASH_F-actin_cap_beta. [Graphical view] |
| PANTHER | PTHR10619. PTHR10619. 1 hit. |
| Pfam | PF01115. F_actin_cap_B. 1 hit. [Graphical view] |
| PRINTS | PR00192. FACTINCAPB. |
| PROSITE | PS00231. F_ACTIN_CAPPING_BETA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CAPZB. human. |
| GenomeRNAi | 832. |
| NextBio | 3446. |
| SOURCE | Search... |
Entry information
| Entry name | CAPZB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P47756 Secondary accession number(s): Q32Q68 Q9NUC4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
