Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-actin-capping protein subunit alpha-2

Gene

CAPZA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActin capping, Actin-binding

Enzyme and pathway databases

ReactomeiR-HSA-2132295 MHC class II antigen presentation
R-HSA-3371497 HSP90 chaperone cycle for steroid hormone receptors (SHR)
R-HSA-6807878 COPI-mediated anterograde transport
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic
R-HSA-879415 Advanced glycosylation endproduct receptor signaling
R-HSA-983231 Factors involved in megakaryocyte development and platelet production

Names & Taxonomyi

Protein namesi
Recommended name:
F-actin-capping protein subunit alpha-2
Alternative name(s):
CapZ alpha-2
Gene namesi
Name:CAPZA2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000198898.12
HGNCiHGNC:1490 CAPZA2
MIMi601571 gene
neXtProtiNX_P47755

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000198898
PharmGKBiPA26071

Polymorphism and mutation databases

BioMutaiCAPZA2
DMDMi1345695

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources2 Publications
ChainiPRO_00002086272 – 286F-actin-capping protein subunit alpha-2Add BLAST285

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei9PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP47755
MaxQBiP47755
PaxDbiP47755
PeptideAtlasiP47755
PRIDEiP47755

2D gel databases

DOSAC-COBS-2DPAGEiP47755
OGPiP47755
REPRODUCTION-2DPAGEiP47755

PTM databases

iPTMnetiP47755
PhosphoSitePlusiP47755

Expressioni

Gene expression databases

BgeeiENSG00000198898
CleanExiHS_CAPZA2
ExpressionAtlasiP47755 baseline and differential
GenevisibleiP47755 HS

Organism-specific databases

HPAiHPA007470
HPA007643

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. Component of the WASH complex, composed of F-actin-capping protein subunit alpha (CAPZA1, CAPZA2 or CAPZA3), F-actin-capping protein subunit beta (CAPZB), WASH (WASHC1, WASH2P, WASH3P, WASH4P, WASH5P or WASH6P), WASHC2 (WASHC2A or WASHC2C), WASHC3, WASHC4 and WASHC5. Interacts with RCSD1/CAPZIP.2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107280, 272 interactors
IntActiP47755, 236 interactors
STRINGi9606.ENSP00000354947

Structurei

3D structure databases

ProteinModelPortaliP47755
SMRiP47755
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0836 Eukaryota
ENOG410ZAWX LUCA
GeneTreeiENSGT00390000006476
HOGENOMiHOG000036539
HOVERGENiHBG050810
InParanoidiP47755
KOiK10364
OMAiWDKVLGY
OrthoDBiEOG091G0KST
PhylomeDBiP47755
TreeFamiTF314822

Family and domain databases

InterProiView protein in InterPro
IPR002189 CapZ_alpha
IPR037282 CapZ_alpha/beta
IPR017865 F-actin_cap_asu_CS
PANTHERiPTHR10653 PTHR10653, 1 hit
PfamiView protein in Pfam
PF01267 F-actin_cap_A, 1 hit
PRINTSiPR00191 FACTINCAPA
SUPFAMiSSF90096 SSF90096, 1 hit
PROSITEiView protein in PROSITE
PS00748 F_ACTIN_CAPPING_A_1, 1 hit
PS00749 F_ACTIN_CAPPING_A_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P47755-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADLEEQLSD EEKVRIAAKF IIHAPPGEFN EVFNDVRLLL NNDNLLREGA
60 70 80 90 100
AHAFAQYNLD QFTPVKIEGY EDQVLITEHG DLGNGKFLDP KNRICFKFDH
110 120 130 140 150
LRKEATDPRP CEVENAVESW RTSVETALRA YVKEHYPNGV CTVYGKKIDG
160 170 180 190 200
QQTIIACIES HQFQAKNFWN GRWRSEWKFT ITPSTTQVVG ILKIQVHYYE
210 220 230 240 250
DGNVQLVSHK DIQDSLTVSN EVQTAKEFIK IVEAAENEYQ TAISENYQTM
260 270 280
SDTTFKALRR QLPVTRTKID WNKILSYKIG KEMQNA
Length:286
Mass (Da):32,949
Last modified:January 23, 2007 - v3
Checksum:iB5E1B617A38E758B
GO
Isoform 2 (identifier: P47755-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     143-172: VYGKKIDGQQTIIACIESHQFQAKNFWNGR → EWSLEVRMEVYNHSFNHSSGWHLENSGSLL
     173-286: Missing.

Note: No experimental confirmation available.
Show »
Length:172
Mass (Da):19,775
Checksum:iF821EBDB7171C078
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_053871143 – 172VYGKK…FWNGR → EWSLEVRMEVYNHSFNHSSG WHLENSGSLL in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_053872173 – 286Missing in isoform 2. 1 PublicationAdd BLAST114

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U03269 mRNA Translation: AAA88848.1
BT006735 mRNA Translation: AAP35381.1
AK294409 mRNA Translation: BAG57661.1
AC002543 Genomic DNA Translation: AAC60382.1
BC005338 mRNA Translation: AAH05338.1
U03851 mRNA Translation: AAC00534.1
CCDSiCCDS5768.1 [P47755-1]
PIRiG01229
RefSeqiNP_006127.1, NM_006136.2 [P47755-1]
UniGeneiHs.446123

Genome annotation databases

EnsembliENST00000361183; ENSP00000354947; ENSG00000198898 [P47755-1]
GeneIDi830
KEGGihsa:830
UCSCiuc003vil.4 human [P47755-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCAZA2_HUMAN
AccessioniPrimary (citable) accession number: P47755
Secondary accession number(s): B4DG50
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: January 23, 2007
Last modified: May 23, 2018
This is version 166 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health