P47736 (RPGP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Rap1 GTPase-activating protein 1 Short name=Rap1GAP Short name=Rap1GAP1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 663 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state. |
| Subunit structure | Homodimer and heterodimer with RAP1B. Ref.10 |
| Subcellular location | |
| Tissue specificity | Significant expression seen in the brain, kidney and pancreas. Abundant in the cerebral cortex and expressed at much lower levels in the spinal cord. Not detected in the lymphoid tissues. Ref.6 |
| Induction | By 12-O-tetradecanoylphorbol-13-acetate (TPA) in promyelocytic HL-60 cells. Ref.6 |
| Sequence similarities | Contains 1 GoLoco domain. Contains 1 Rap-GAP domain. |
| Sequence caution | The sequence BAA32319.3 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P47736-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P47736-2) The sequence of this isoform differs from the canonical sequence as follows: 476-476: I → ISLLIPGKSASRFGRRGSAIGIGTVEE 626-633: Missing. | ||||||
| Isoform 3 (identifier: P47736-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAQLRPAVPPGRPRRGSLPAGASWQNTDLFEM 280-280: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 663 | 663 | Rap1 GTPase-activating protein 1 | PRO_0000056743 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1 – 17 | 17 | GoLoco | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 181 – 397 | 217 | Rap-GAP | |||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 262 | 1 | N6-acetyllysine Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 384 | 1 | N6-acetyllysine Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 441 | 1 | Phosphoserine Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 484 | 1 | Phosphoserine Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 499 | 1 | Phosphoserine Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MAQLRPAVPPGRPRRGSLPA GASWQNTDLFEM in isoform 3. | VSP_040260 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 280 | 1 | Missing in isoform 3. | VSP_040261 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 476 | 1 | I → ISLLIPGKSASRFGRRGSAI GIGTVEE in isoform 2. | VSP_035256 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 626 – 633 | 8 | Missing in isoform 2. | VSP_035257 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 107 | 1 | A → T. Ref.1 Corresponds to variant rs2275363 [ dbSNP | Ensembl ]. | VAR_047792 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 257 | 1 | C → R in a breast cancer sample; somatic mutation. Ref.11 | VAR_035547 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 609 | 1 | Y → C in a breast cancer sample; somatic mutation. Ref.11 | VAR_035548 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 85 – 88 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 89 – 93 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 94 – 96 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 100 – 106 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 107 – 109 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 110 – 121 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 124 – 132 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 137 – 143 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 153 – 160 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 177 – 186 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 192 – 200 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 207 – 211 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 218 – 227 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 228 – 233 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 245 – 247 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 252 – 258 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 263 – 268 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 269 – 271 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 282 – 288 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 292 – 300 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 306 – 308 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 316 – 323 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 331 – 338 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 354 – 358 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 359 – 376 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 380 – 409 | 30 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of a GTPase activating protein specific for the Krev-1 protein p21rap1." Rubinfeld B., Munemitsu S., Clark R., Conroy L., Watt K., Crosier W.J., McCormick F., Polakis P. Cell 65:1033-1042(1991) [PubMed: 1904317] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-107. Tissue: Brain. |
| [2] | "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain." Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O. DNA Res. 4:345-349(1997) [PubMed: 9455484] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Activation of the ERK/MAPK pathway by an isoform of rap1GAP associated with G alpha(i)." Mochizuki N., Ohba Y., Kiyokawa E., Kurata T., Murakami Y., Ozaki Y., Kitakabe A., Nagashima K., Matsuda M. Nature 400:891-894(1999) [PubMed: 10476970] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-100 (ISOFORM 3). Tissue: Brain. |
| [6] | "Human SPA-1 product selectively expressed in lymphoid tissues is a specific GTPase-activating protein for Rap1 and Rap2." Kurachi H., Wada Y., Tsukamoto N., Maeda M., Kubota H., Hattori M., Iwai K., Minato N. J. Biol. Chem. 272:28081-28088(1997) [PubMed: 9346962] [Abstract] Cited for: TISSUE SPECIFICITY, INDUCTION. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-484 AND SER-499, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-441, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [9] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-262 AND LYS-384, MASS SPECTROMETRY. |
| [10] | "The Rap-RapGAP complex: GTP hydrolysis without catalytic glutamine and arginine residues." Scrima A., Thomas C., Deaconescu D., Wittinghofer A. EMBO J. 27:1145-1153(2008) [PubMed: 18309292] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.4 ANGSTROMS) OF 1-167 IN COMPLEX WITH RAP1B, SUBUNIT. |
| [11] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ARG-257 AND CYS-609. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M64788 mRNA. Translation: AAA60252.1. AB003930 mRNA. Translation: BAA83674.1. AB007943 mRNA. Translation: BAA32319.3. Different initiation. AL359815 Genomic DNA. Translation: CAI16250.1. AL359815 Genomic DNA. Translation: CAI16255.1. CH471134 Genomic DNA. Translation: EAW94980.1. | ||||||||||||||||||
| IPI | IPI00386930. IPI00843926. IPI01013142. | ||||||||||||||||||
| PIR | A39897. B39897. | ||||||||||||||||||
| RefSeq | NP_001139129.1. NM_001145657.1. NP_002876.2. NM_002885.2. | ||||||||||||||||||
| UniGene | Hs.148178. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P47736. | ||||||||||||||||||
| SMR | P47736. Positions 78-414. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | P47736. 2 interactions. | ||||||||||||||||||
| MINT | MINT-3308298. | ||||||||||||||||||
| STRING | P47736. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P47736. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 215273877. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | P47736. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000290101; ENSP00000290101; ENSG00000076864. ENST00000317967; ENSP00000315420; ENSG00000076864. ENST00000359708; ENSP00000352739; ENSG00000076864. ENST00000374757; ENSP00000363889; ENSG00000076864. ENST00000374758; ENSP00000363890; ENSG00000076864. ENST00000374761; ENSP00000363893; ENSG00000076864. ENST00000374763; ENSP00000363895; ENSG00000076864. ENST00000374765; ENSP00000363897; ENSG00000076864. ENST00000374772; ENSP00000363904; ENSG00000076864. ENST00000447293; ENSP00000392717; ENSG00000076864. | ||||||||||||||||||
| GeneID | 5909. | ||||||||||||||||||
| KEGG | hsa:5909. | ||||||||||||||||||
| UCSC | uc001bex.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 5909. | ||||||||||||||||||
| GeneCards | GC01M021922. | ||||||||||||||||||
| HGNC | HGNC:9858. RAP1GAP. | ||||||||||||||||||
| HPA | CAB003851. HPA001922. | ||||||||||||||||||
| MIM | 600278. gene. | ||||||||||||||||||
| neXtProt | NX_P47736. | ||||||||||||||||||
| PharmGKB | PA34220. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOGENOM | HBG445308. | ||||||||||||||||||
| HOVERGEN | HBG016371. | ||||||||||||||||||
| OrthoDB | EOG43FGWB. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P47736. | ||||||||||||||||||
| Bgee | P47736. | ||||||||||||||||||
| CleanEx | HS_RAP1GAP. | ||||||||||||||||||
| Genevestigator | P47736. | ||||||||||||||||||
| GermOnline | ENSG00000076864. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR003109. GoLoco_motif. IPR000331. Rap_GAP. [Graphical view] | ||||||||||||||||||
| Pfam | PF02188. GoLoco. 1 hit. PF02145. Rap_GAP. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00390. GoLoco. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS50877. GOLOCO. 1 hit. PS50085. RAPGAP. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 22986. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | RPGP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P47736 Secondary accession number(s): O75062 Q9UQ51 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with