Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P47245 (NRDC_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 106. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Nardilysin

EC=3.4.24.61
Alternative name(s):
N-arginine dibasic convertase
Short name=NRD convertase
Short name=NRD-C
Gene names
Name:Nrd1
Synonyms:Nrdc
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length1161 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

Catalytic activity

Hydrolysis of polypeptides, preferably at -Xaa-|-Arg-Lys-, and less commonly at -Arg-|-Arg-Xaa-, in which Xaa is not Arg or Lys.

Cofactor

Binds 1 zinc ion per subunit By similarity.

Tissue specificity

Testis, and in a lower level in brain, heart and adrenal glands.

Sequence similarities

Belongs to the peptidase M16 family.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   DomainSignal
   LigandMetal-binding
Zinc
   Molecular functionHydrolase
Metalloprotease
Protease
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processproteolysis

Inferred from electronic annotation. Source: UniProtKB-KW

   Molecular_functionmetal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

metalloendopeptidase activity

Inferred from electronic annotation. Source: InterPro

peptidase activity

Inferred from direct assay PubMed 15809022. Source: MGI

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P47245-1)

Also known as: NRD1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P47245-2)

Also known as: NRD2;

The sequence of this isoform differs from the canonical sequence as follows:
     221-221: Q → QQSQNLFLLWSKLTDRLWFKSSYSKMSSTLLVETRNLYGVVGAESRSAPVEHLAGWQVEEQQGETDTVL

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1818 Potential
Chain19 – 11611143Nardilysin
PRO_0000026757

Regions

Compositional bias139 – 20971Asp/Glu-rich (highly acidic)
Compositional bias140 – 15920Poly-Glu
Compositional bias160 – 1689Poly-Asp
Compositional bias193 – 1986Poly-Asp

Sites

Active site2471Proton acceptor By similarity
Metal binding2441Zinc By similarity
Metal binding2481Zinc By similarity
Metal binding3251Zinc By similarity

Amino acid modifications

Modified residue851Phosphoserine By similarity
Modified residue911Phosphoserine By similarity

Natural variations

Alternative sequence2211Q → QQSQNLFLLWSKLTDRLWFK SSYSKMSSTLLVETRNLYGV VGAESRSAPVEHLAGWQVEE QQGETDTVL in isoform 2.
VSP_007115

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (NRD1) [UniParc].

Last modified February 1, 1996. Version 1.
Checksum: 64A0CCEFB29386BB

FASTA1,161132,976
        10         20         30         40         50         60 
MLRRVAVAAV FATGRKLRCE AGRDVTAVGR IEARGLCEES AKPFPTLTMP GRNKAKSTCS 

        70         80         90        100        110        120 
CPDLQPNGQD LGESGRVARL GADESEEEGR SLSNVGDPEI IKSPSDPKQY RYIKLQNGLQ 

       130        140        150        160        170        180 
ALLISDLSNV EGKTGNATDE EEEEEEEEEE GEEEEEEEED DDDDDDEDSG AEIQDDDEEG 

       190        200        210        220        230        240 
FDDEEEFDDD EHDDDDLDNE ENELEELEER VEARKKTTEK QSAAALCVGV GSFADPDDLP 

       250        260        270        280        290        300 
GLAHFLEHMV FMGSLKYPDE NGFDAFLKKH GGSDNASTDC ERTVFQFDVQ RKYFKEALDR 

       310        320        330        340        350        360 
WAQFFIHPLM IRDAIDREVE AVDSEYQLAR PSDANRKEML FGSLARPGHP MGKFFWGNAE 

       370        380        390        400        410        420 
TLKHEPKKNN IDTHARLREF WMRYYSAHYM TLVVQSKETL DTLEKWVTEI FSQIPNNGLP 

       430        440        450        460        470        480 
KPNFSHLTDP FDTPAFNKLY RVVPIRKIHA LTITWALPPQ QQHYRVKPLH YISWLVGHEG 

       490        500        510        520        530        540 
KGSILSYLRK KCWALALFGG NGETGFEQNS TYSVFSISIT LTDEGYEHFY EVAHTVFQYL 

       550        560        570        580        590        600 
KMLQKLGPEK RVFEEIQKIE DNEFHYQEQT DPVEYVENMC ENMQLYPRQD FLTGDQLLFE 

       610        620        630        640        650        660 
YKPEVIAEAL NQLVPQKANL VLLSGANEGR CDLKEKWFGT QYSIEDIENS WTELWKSNFD 

       670        680        690        700        710        720 
LNSDLHLPAE NKYIATDFTL KAFDCPETEY PAKIVNTPQG CLWYKKDNKF KIPKAYIRFH 

       730        740        750        760        770        780 
LISPLIQKSA ANVVLFDIFV NILTHNLAEP AYEADVAQLE YKLVAGEHGL IIRVKGFNHK 

       790        800        810        820        830        840 
LPLLFQLIID YLTEFSSTPA VFTMITEQLK KTYFNILIKP ETLAKDVRLL ILEYSRWSMI 

       850        860        870        880        890        900 
DKYRALMDGL SLESLLNFVK DFKSQLFVEG LVQGNVTSTE SMDFLRYVVD KLNFVPLERE 

       910        920        930        940        950        960 
MPVQFQVVEL PSGHHLCKVR ALNKGDANSE VTVYYQSGTR SLREYTLMEL LVMHMEEPCF 

       970        980        990       1000       1010       1020 
DFLRTKQTLG YHVYPTCRNT SGILGFSVTV GTQATKYNSE TVDKKIEEFL SSFEEKIENL 

      1030       1040       1050       1060       1070       1080 
TEDAFNTQVT ALIKLKECED THLGEEVDRN WNEVVTQQYL FDRLAHEIEA LKSFSKSDLV 

      1090       1100       1110       1120       1130       1140 
SWFKAHRGPG SKMLSVHVVG YGKYELEEDG APVCEDPNSR EGMQLIYLPP SPLLAESTTP 

      1150       1160 
ITDIRAFTAT LSLFPYHKIV K 

« Hide

Isoform 2 (NRD2) [UniParc].

Checksum: 36298E4D7ED71F4E
Show »

FASTA1,229140,704

References

[1]"N-arginine dibasic convertase, a metalloendopeptidase as a prototype of a class of processing enzymes."
Pierotti A.R., Prat A., Chesneau V., Gaudoux F., Leseney A.-M., Foulon T., Cohen P.
Proc. Natl. Acad. Sci. U.S.A. 91:6078-6082(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Testis.
[2]"Human and rat testis express two mRNA species encoding variants of NRD convertase, a metalloendopeptidase of the insulinase family."
Hospital V., Prat A., Joulie C., Cherif D., Day R., Cohen P.
Biochem. J. 327:773-779(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Tissue: Testis.
[3]"N-arginine dibasic convertase (NRD convertase): a newcomer to the family of processing endopeptidases. An overview."
Chesneau V., Pierotti A.R., Prat A., Gaudoux F., Foulon T., Cohen P.
Biochimie 76:234-240(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: DISCUSSION OF SEQUENCE.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L27124 mRNA. Translation: AAA21818.1.
X93208 mRNA. Translation: CAA63696.1.
PIRI59311.
RefSeqNP_037125.1. NM_012993.2.
UniGeneRn.203027.

3D structure databases

ProteinModelPortalP47245.
ModBaseSearch...
MobiDBSearch...

Protein family/group databases

MEROPSM16.005.

PTM databases

PhosphoSiteP47245.

Proteomic databases

PaxDbP47245.
PRIDEP47245.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID25499.
KEGGrno:25499.
UCSCRGD:3210. rat. [P47245-1]

Organism-specific databases

CTD4898.
RGD3210. Nrd1.

Phylogenomic databases

eggNOGCOG1025.
HOGENOMHOG000231160.
HOVERGENHBG006530.
KOK01411.
PhylomeDBP47245.

Gene expression databases

GenevestigatorP47245.

Family and domain databases

Gene3D3.30.830.10. 5 hits.
InterProIPR011249. Metalloenz_LuxS/M16.
IPR011237. Pept_M16_dom.
IPR011765. Pept_M16_N.
IPR001431. Pept_M16_Zn_BS.
IPR007863. Peptidase_M16_C.
[Graphical view]
PfamPF00675. Peptidase_M16. 1 hit.
PF05193. Peptidase_M16_C. 2 hits.
[Graphical view]
SUPFAMSSF63411. SSF63411. 5 hits.
PROSITEPS00143. INSULINASE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio606901.
PROP47245.

Entry information

Entry nameNRDC_RAT
AccessionPrimary (citable) accession number: P47245
Secondary accession number(s): O35836
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: February 1, 1996
Last modified: April 16, 2014
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries