P47245 (NRDC_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 99.
History...
Clusters with 
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nardilysin EC=3.4.24.61 Alternative name(s): N-arginine dibasic convertase Short name=NRD convertase Short name=NRD-C | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 1161 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs. |
| Catalytic activity | Hydrolysis of polypeptides, preferably at -Xaa-|-Arg-Lys-, and less commonly at -Arg-|-Arg-Xaa-, in which Xaa is not Arg or Lys. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Tissue specificity | Testis, and in a lower level in brain, heart and adrenal glands. |
| Sequence similarities | Belongs to the peptidase M16 family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Ligand | Metal-binding Zinc |
| Molecular function | Hydrolase Metalloprotease Protease |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | proteolysis Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW metalloendopeptidase activityInferred from electronic annotation. Source: InterPro peptidase activityInferred from direct assay PubMed 15809022. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P47245-1) Also known as: NRD1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P47245-2) Also known as: NRD2; The sequence of this isoform differs from the canonical sequence as follows: 221-221: Q → QQSQNLFLLWSKLTDRLWFKSSYSKMSSTLLVETRNLYGVVGAESRSAPVEHLAGWQVEEQQGETDTVL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 18 | 18 | Potential | ||||||
| Chain | 19 – 1161 | 1143 | Nardilysin | PRO_0000026757 | |||||
Regions | |||||||||
| Compositional bias | 139 – 209 | 71 | Asp/Glu-rich (highly acidic) | ||||||
| Compositional bias | 140 – 159 | 20 | Poly-Glu | ||||||
| Compositional bias | 160 – 168 | 9 | Poly-Asp | ||||||
| Compositional bias | 193 – 198 | 6 | Poly-Asp | ||||||
Sites | |||||||||
| Active site | 247 | 1 | Proton acceptor By similarity | ||||||
| Metal binding | 244 | 1 | Zinc By similarity | ||||||
| Metal binding | 248 | 1 | Zinc By similarity | ||||||
| Metal binding | 325 | 1 | Zinc By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 85 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 91 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 221 | 1 | Q → QQSQNLFLLWSKLTDRLWFK SSYSKMSSTLLVETRNLYGV VGAESRSAPVEHLAGWQVEE QQGETDTVL in isoform 2. | VSP_007115 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "N-arginine dibasic convertase, a metalloendopeptidase as a prototype of a class of processing enzymes." Pierotti A.R., Prat A., Chesneau V., Gaudoux F., Leseney A.-M., Foulon T., Cohen P. Proc. Natl. Acad. Sci. U.S.A. 91:6078-6082(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Testis. |
| [2] | "Human and rat testis express two mRNA species encoding variants of NRD convertase, a metalloendopeptidase of the insulinase family." Hospital V., Prat A., Joulie C., Cherif D., Day R., Cohen P. Biochem. J. 327:773-779(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Testis. |
| [3] | "N-arginine dibasic convertase (NRD convertase): a newcomer to the family of processing endopeptidases. An overview." Chesneau V., Pierotti A.R., Prat A., Gaudoux F., Foulon T., Cohen P. Biochimie 76:234-240(1994) [PubMed] [Europe PMC] [Abstract] Cited for: DISCUSSION OF SEQUENCE. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L27124 mRNA. Translation: AAA21818.1. X93208 mRNA. Translation: CAA63696.1. |
| IPI | IPI00213669. IPI00285619. |
| PIR | I59311. |
| RefSeq | NP_037125.1. NM_012993.2. |
| UniGene | Rn.203027. |
3D structure databases | |
| ProteinModelPortal | P47245. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | M16.005. |
PTM databases | |
| PhosphoSite | P47245. |
Proteomic databases | |
| PaxDb | P47245. |
| PRIDE | P47245. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 25499. |
| KEGG | rno:25499. |
| UCSC | RGD:3210. rat. |
Organism-specific databases | |
| CTD | 4898. |
| RGD | 3210. Nrd1. |
Phylogenomic databases | |
| eggNOG | COG1025. |
| HOGENOM | HOG000231160. |
| HOVERGEN | HBG006530. |
| KO | K01411. |
Gene expression databases | |
| ArrayExpress | P47245. |
| Genevestigator | P47245. |
| GermOnline | ENSRNOG00000007111. Rattus norvegicus. |
Family and domain databases | |
| Gene3D | 3.30.830.10. 5 hits. |
| InterPro | IPR011249. Metalloenz_LuxS/M16. IPR011237. Pept_M16_dom. IPR011765. Pept_M16_N. IPR001431. Pept_M16_Zn_BS. IPR007863. Peptidase_M16_C. [Graphical view] |
| Pfam | PF00675. Peptidase_M16. 1 hit. PF05193. Peptidase_M16_C. 2 hits. [Graphical view] |
| SUPFAM | SSF63411. Metalloenz_metal-bd. 4 hits. |
| PROSITE | PS00143. INSULINASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 606901. |
Entry information
| Entry name | NRDC_RAT | ||||||||
| Accession | Primary (citable) accession number: P47245 Secondary accession number(s): O35836 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |