Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P47245

- NRDC_RAT

UniProt

P47245 - NRDC_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nardilysin

Gene

Nrd1

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

Catalytic activityi

Hydrolysis of polypeptides, preferably at -Xaa-|-Arg-Lys-, and less commonly at -Arg-|-Arg-Xaa-, in which Xaa is not Arg or Lys.

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi244 – 2441ZincPROSITE-ProRule annotation
Active sitei247 – 2471Proton acceptorPROSITE-ProRule annotation
Metal bindingi248 – 2481ZincPROSITE-ProRule annotation
Metal bindingi325 – 3251ZincPROSITE-ProRule annotation

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. metalloendopeptidase activity Source: InterPro
  3. peptidase activity Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM16.005.

Names & Taxonomyi

Protein namesi
Recommended name:
Nardilysin (EC:3.4.24.61)
Alternative name(s):
N-arginine dibasic convertase
Short name:
NRD convertase
Short name:
NRD-C
Gene namesi
Name:Nrd1
Synonyms:Nrdc
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi3210. Nrd1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1818Sequence AnalysisAdd
BLAST
Chaini19 – 11611143NardilysinPRO_0000026757Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei85 – 851PhosphoserineBy similarity
Modified residuei91 – 911PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP47245.
PRIDEiP47245.

PTM databases

PhosphoSiteiP47245.

Expressioni

Tissue specificityi

Testis, and in a lower level in brain, heart and adrenal glands.

Gene expression databases

GenevestigatoriP47245.

Structurei

3D structure databases

ProteinModelPortaliP47245.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi139 – 20971Asp/Glu-rich (highly acidic)Add
BLAST
Compositional biasi140 – 15920Poly-GluAdd
BLAST
Compositional biasi160 – 1689Poly-Asp
Compositional biasi193 – 1986Poly-Asp

Sequence similaritiesi

Belongs to the peptidase M16 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG1025.
HOGENOMiHOG000231160.
HOVERGENiHBG006530.
InParanoidiP47245.
KOiK01411.
PhylomeDBiP47245.

Family and domain databases

Gene3Di3.30.830.10. 5 hits.
InterProiIPR011249. Metalloenz_LuxS/M16.
IPR011237. Pept_M16_dom.
IPR011765. Pept_M16_N.
IPR001431. Pept_M16_Zn_BS.
IPR007863. Peptidase_M16_C.
[Graphical view]
PfamiPF00675. Peptidase_M16. 1 hit.
PF05193. Peptidase_M16_C. 2 hits.
[Graphical view]
SUPFAMiSSF63411. SSF63411. 5 hits.
PROSITEiPS00143. INSULINASE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P47245-1) [UniParc]FASTAAdd to Basket

Also known as: NRD1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLRRVAVAAV FATGRKLRCE AGRDVTAVGR IEARGLCEES AKPFPTLTMP
60 70 80 90 100
GRNKAKSTCS CPDLQPNGQD LGESGRVARL GADESEEEGR SLSNVGDPEI
110 120 130 140 150
IKSPSDPKQY RYIKLQNGLQ ALLISDLSNV EGKTGNATDE EEEEEEEEEE
160 170 180 190 200
GEEEEEEEED DDDDDDEDSG AEIQDDDEEG FDDEEEFDDD EHDDDDLDNE
210 220 230 240 250
ENELEELEER VEARKKTTEK QSAAALCVGV GSFADPDDLP GLAHFLEHMV
260 270 280 290 300
FMGSLKYPDE NGFDAFLKKH GGSDNASTDC ERTVFQFDVQ RKYFKEALDR
310 320 330 340 350
WAQFFIHPLM IRDAIDREVE AVDSEYQLAR PSDANRKEML FGSLARPGHP
360 370 380 390 400
MGKFFWGNAE TLKHEPKKNN IDTHARLREF WMRYYSAHYM TLVVQSKETL
410 420 430 440 450
DTLEKWVTEI FSQIPNNGLP KPNFSHLTDP FDTPAFNKLY RVVPIRKIHA
460 470 480 490 500
LTITWALPPQ QQHYRVKPLH YISWLVGHEG KGSILSYLRK KCWALALFGG
510 520 530 540 550
NGETGFEQNS TYSVFSISIT LTDEGYEHFY EVAHTVFQYL KMLQKLGPEK
560 570 580 590 600
RVFEEIQKIE DNEFHYQEQT DPVEYVENMC ENMQLYPRQD FLTGDQLLFE
610 620 630 640 650
YKPEVIAEAL NQLVPQKANL VLLSGANEGR CDLKEKWFGT QYSIEDIENS
660 670 680 690 700
WTELWKSNFD LNSDLHLPAE NKYIATDFTL KAFDCPETEY PAKIVNTPQG
710 720 730 740 750
CLWYKKDNKF KIPKAYIRFH LISPLIQKSA ANVVLFDIFV NILTHNLAEP
760 770 780 790 800
AYEADVAQLE YKLVAGEHGL IIRVKGFNHK LPLLFQLIID YLTEFSSTPA
810 820 830 840 850
VFTMITEQLK KTYFNILIKP ETLAKDVRLL ILEYSRWSMI DKYRALMDGL
860 870 880 890 900
SLESLLNFVK DFKSQLFVEG LVQGNVTSTE SMDFLRYVVD KLNFVPLERE
910 920 930 940 950
MPVQFQVVEL PSGHHLCKVR ALNKGDANSE VTVYYQSGTR SLREYTLMEL
960 970 980 990 1000
LVMHMEEPCF DFLRTKQTLG YHVYPTCRNT SGILGFSVTV GTQATKYNSE
1010 1020 1030 1040 1050
TVDKKIEEFL SSFEEKIENL TEDAFNTQVT ALIKLKECED THLGEEVDRN
1060 1070 1080 1090 1100
WNEVVTQQYL FDRLAHEIEA LKSFSKSDLV SWFKAHRGPG SKMLSVHVVG
1110 1120 1130 1140 1150
YGKYELEEDG APVCEDPNSR EGMQLIYLPP SPLLAESTTP ITDIRAFTAT
1160
LSLFPYHKIV K
Length:1,161
Mass (Da):132,976
Last modified:February 1, 1996 - v1
Checksum:i64A0CCEFB29386BB
GO
Isoform 2 (identifier: P47245-2) [UniParc]FASTAAdd to Basket

Also known as: NRD2

The sequence of this isoform differs from the canonical sequence as follows:
     221-221: Q → QQSQNLFLLWSKLTDRLWFKSSYSKMSSTLLVETRNLYGVVGAESRSAPVEHLAGWQVEEQQGETDTVL

Show »
Length:1,229
Mass (Da):140,704
Checksum:i36298E4D7ED71F4E
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei221 – 2211Q → QQSQNLFLLWSKLTDRLWFK SSYSKMSSTLLVETRNLYGV VGAESRSAPVEHLAGWQVEE QQGETDTVL in isoform 2. 1 PublicationVSP_007115

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L27124 mRNA. Translation: AAA21818.1.
X93208 mRNA. Translation: CAA63696.1.
PIRiI59311.
RefSeqiNP_037125.1. NM_012993.2. [P47245-1]
UniGeneiRn.203027.

Genome annotation databases

GeneIDi25499.
KEGGirno:25499.
UCSCiRGD:3210. rat. [P47245-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L27124 mRNA. Translation: AAA21818.1 .
X93208 mRNA. Translation: CAA63696.1 .
PIRi I59311.
RefSeqi NP_037125.1. NM_012993.2. [P47245-1 ]
UniGenei Rn.203027.

3D structure databases

ProteinModelPortali P47245.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

MEROPSi M16.005.

PTM databases

PhosphoSitei P47245.

Proteomic databases

PaxDbi P47245.
PRIDEi P47245.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 25499.
KEGGi rno:25499.
UCSCi RGD:3210. rat. [P47245-1 ]

Organism-specific databases

CTDi 4898.
RGDi 3210. Nrd1.

Phylogenomic databases

eggNOGi COG1025.
HOGENOMi HOG000231160.
HOVERGENi HBG006530.
InParanoidi P47245.
KOi K01411.
PhylomeDBi P47245.

Miscellaneous databases

NextBioi 606901.
PROi P47245.

Gene expression databases

Genevestigatori P47245.

Family and domain databases

Gene3Di 3.30.830.10. 5 hits.
InterProi IPR011249. Metalloenz_LuxS/M16.
IPR011237. Pept_M16_dom.
IPR011765. Pept_M16_N.
IPR001431. Pept_M16_Zn_BS.
IPR007863. Peptidase_M16_C.
[Graphical view ]
Pfami PF00675. Peptidase_M16. 1 hit.
PF05193. Peptidase_M16_C. 2 hits.
[Graphical view ]
SUPFAMi SSF63411. SSF63411. 5 hits.
PROSITEi PS00143. INSULINASE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "N-arginine dibasic convertase, a metalloendopeptidase as a prototype of a class of processing enzymes."
    Pierotti A.R., Prat A., Chesneau V., Gaudoux F., Leseney A.-M., Foulon T., Cohen P.
    Proc. Natl. Acad. Sci. U.S.A. 91:6078-6082(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. "Human and rat testis express two mRNA species encoding variants of NRD convertase, a metalloendopeptidase of the insulinase family."
    Hospital V., Prat A., Joulie C., Cherif D., Day R., Cohen P.
    Biochem. J. 327:773-779(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Testis.
  3. "N-arginine dibasic convertase (NRD convertase): a newcomer to the family of processing endopeptidases. An overview."
    Chesneau V., Pierotti A.R., Prat A., Gaudoux F., Foulon T., Cohen P.
    Biochimie 76:234-240(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISCUSSION OF SEQUENCE.

Entry informationi

Entry nameiNRDC_RAT
AccessioniPrimary (citable) accession number: P47245
Secondary accession number(s): O35836
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: February 1, 1996
Last modified: November 26, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3