Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P47245

- NRDC_RAT

UniProt

P47245 - NRDC_RAT

Protein

Nardilysin

Gene

Nrd1

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 108 (01 Oct 2014)
      Sequence version 1 (01 Feb 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

    Catalytic activityi

    Hydrolysis of polypeptides, preferably at -Xaa-|-Arg-Lys-, and less commonly at -Arg-|-Arg-Xaa-, in which Xaa is not Arg or Lys.

    Cofactori

    Binds 1 zinc ion per subunit.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi244 – 2441ZincPROSITE-ProRule annotation
    Active sitei247 – 2471Proton acceptorPROSITE-ProRule annotation
    Metal bindingi248 – 2481ZincPROSITE-ProRule annotation
    Metal bindingi325 – 3251ZincPROSITE-ProRule annotation

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. metalloendopeptidase activity Source: InterPro
    3. peptidase activity Source: MGI

    Keywords - Molecular functioni

    Hydrolase, Metalloprotease, Protease

    Keywords - Ligandi

    Metal-binding, Zinc

    Protein family/group databases

    MEROPSiM16.005.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nardilysin (EC:3.4.24.61)
    Alternative name(s):
    N-arginine dibasic convertase
    Short name:
    NRD convertase
    Short name:
    NRD-C
    Gene namesi
    Name:Nrd1
    Synonyms:Nrdc
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi3210. Nrd1.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1818Sequence AnalysisAdd
    BLAST
    Chaini19 – 11611143NardilysinPRO_0000026757Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei85 – 851PhosphoserineBy similarity
    Modified residuei91 – 911PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiP47245.
    PRIDEiP47245.

    PTM databases

    PhosphoSiteiP47245.

    Expressioni

    Tissue specificityi

    Testis, and in a lower level in brain, heart and adrenal glands.

    Gene expression databases

    GenevestigatoriP47245.

    Structurei

    3D structure databases

    ProteinModelPortaliP47245.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi139 – 20971Asp/Glu-rich (highly acidic)Add
    BLAST
    Compositional biasi140 – 15920Poly-GluAdd
    BLAST
    Compositional biasi160 – 1689Poly-Asp
    Compositional biasi193 – 1986Poly-Asp

    Sequence similaritiesi

    Belongs to the peptidase M16 family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiCOG1025.
    HOGENOMiHOG000231160.
    HOVERGENiHBG006530.
    KOiK01411.
    PhylomeDBiP47245.

    Family and domain databases

    Gene3Di3.30.830.10. 5 hits.
    InterProiIPR011249. Metalloenz_LuxS/M16.
    IPR011237. Pept_M16_dom.
    IPR011765. Pept_M16_N.
    IPR001431. Pept_M16_Zn_BS.
    IPR007863. Peptidase_M16_C.
    [Graphical view]
    PfamiPF00675. Peptidase_M16. 1 hit.
    PF05193. Peptidase_M16_C. 2 hits.
    [Graphical view]
    SUPFAMiSSF63411. SSF63411. 5 hits.
    PROSITEiPS00143. INSULINASE. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P47245-1) [UniParc]FASTAAdd to Basket

    Also known as: NRD1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLRRVAVAAV FATGRKLRCE AGRDVTAVGR IEARGLCEES AKPFPTLTMP     50
    GRNKAKSTCS CPDLQPNGQD LGESGRVARL GADESEEEGR SLSNVGDPEI 100
    IKSPSDPKQY RYIKLQNGLQ ALLISDLSNV EGKTGNATDE EEEEEEEEEE 150
    GEEEEEEEED DDDDDDEDSG AEIQDDDEEG FDDEEEFDDD EHDDDDLDNE 200
    ENELEELEER VEARKKTTEK QSAAALCVGV GSFADPDDLP GLAHFLEHMV 250
    FMGSLKYPDE NGFDAFLKKH GGSDNASTDC ERTVFQFDVQ RKYFKEALDR 300
    WAQFFIHPLM IRDAIDREVE AVDSEYQLAR PSDANRKEML FGSLARPGHP 350
    MGKFFWGNAE TLKHEPKKNN IDTHARLREF WMRYYSAHYM TLVVQSKETL 400
    DTLEKWVTEI FSQIPNNGLP KPNFSHLTDP FDTPAFNKLY RVVPIRKIHA 450
    LTITWALPPQ QQHYRVKPLH YISWLVGHEG KGSILSYLRK KCWALALFGG 500
    NGETGFEQNS TYSVFSISIT LTDEGYEHFY EVAHTVFQYL KMLQKLGPEK 550
    RVFEEIQKIE DNEFHYQEQT DPVEYVENMC ENMQLYPRQD FLTGDQLLFE 600
    YKPEVIAEAL NQLVPQKANL VLLSGANEGR CDLKEKWFGT QYSIEDIENS 650
    WTELWKSNFD LNSDLHLPAE NKYIATDFTL KAFDCPETEY PAKIVNTPQG 700
    CLWYKKDNKF KIPKAYIRFH LISPLIQKSA ANVVLFDIFV NILTHNLAEP 750
    AYEADVAQLE YKLVAGEHGL IIRVKGFNHK LPLLFQLIID YLTEFSSTPA 800
    VFTMITEQLK KTYFNILIKP ETLAKDVRLL ILEYSRWSMI DKYRALMDGL 850
    SLESLLNFVK DFKSQLFVEG LVQGNVTSTE SMDFLRYVVD KLNFVPLERE 900
    MPVQFQVVEL PSGHHLCKVR ALNKGDANSE VTVYYQSGTR SLREYTLMEL 950
    LVMHMEEPCF DFLRTKQTLG YHVYPTCRNT SGILGFSVTV GTQATKYNSE 1000
    TVDKKIEEFL SSFEEKIENL TEDAFNTQVT ALIKLKECED THLGEEVDRN 1050
    WNEVVTQQYL FDRLAHEIEA LKSFSKSDLV SWFKAHRGPG SKMLSVHVVG 1100
    YGKYELEEDG APVCEDPNSR EGMQLIYLPP SPLLAESTTP ITDIRAFTAT 1150
    LSLFPYHKIV K 1161
    Length:1,161
    Mass (Da):132,976
    Last modified:February 1, 1996 - v1
    Checksum:i64A0CCEFB29386BB
    GO
    Isoform 2 (identifier: P47245-2) [UniParc]FASTAAdd to Basket

    Also known as: NRD2

    The sequence of this isoform differs from the canonical sequence as follows:
         221-221: Q → QQSQNLFLLWSKLTDRLWFKSSYSKMSSTLLVETRNLYGVVGAESRSAPVEHLAGWQVEEQQGETDTVL

    Show »
    Length:1,229
    Mass (Da):140,704
    Checksum:i36298E4D7ED71F4E
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei221 – 2211Q → QQSQNLFLLWSKLTDRLWFK SSYSKMSSTLLVETRNLYGV VGAESRSAPVEHLAGWQVEE QQGETDTVL in isoform 2. 1 PublicationVSP_007115

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L27124 mRNA. Translation: AAA21818.1.
    X93208 mRNA. Translation: CAA63696.1.
    PIRiI59311.
    RefSeqiNP_037125.1. NM_012993.2. [P47245-1]
    UniGeneiRn.203027.

    Genome annotation databases

    GeneIDi25499.
    KEGGirno:25499.
    UCSCiRGD:3210. rat. [P47245-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L27124 mRNA. Translation: AAA21818.1 .
    X93208 mRNA. Translation: CAA63696.1 .
    PIRi I59311.
    RefSeqi NP_037125.1. NM_012993.2. [P47245-1 ]
    UniGenei Rn.203027.

    3D structure databases

    ProteinModelPortali P47245.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    MEROPSi M16.005.

    PTM databases

    PhosphoSitei P47245.

    Proteomic databases

    PaxDbi P47245.
    PRIDEi P47245.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 25499.
    KEGGi rno:25499.
    UCSCi RGD:3210. rat. [P47245-1 ]

    Organism-specific databases

    CTDi 4898.
    RGDi 3210. Nrd1.

    Phylogenomic databases

    eggNOGi COG1025.
    HOGENOMi HOG000231160.
    HOVERGENi HBG006530.
    KOi K01411.
    PhylomeDBi P47245.

    Miscellaneous databases

    NextBioi 606901.
    PROi P47245.

    Gene expression databases

    Genevestigatori P47245.

    Family and domain databases

    Gene3Di 3.30.830.10. 5 hits.
    InterProi IPR011249. Metalloenz_LuxS/M16.
    IPR011237. Pept_M16_dom.
    IPR011765. Pept_M16_N.
    IPR001431. Pept_M16_Zn_BS.
    IPR007863. Peptidase_M16_C.
    [Graphical view ]
    Pfami PF00675. Peptidase_M16. 1 hit.
    PF05193. Peptidase_M16_C. 2 hits.
    [Graphical view ]
    SUPFAMi SSF63411. SSF63411. 5 hits.
    PROSITEi PS00143. INSULINASE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "N-arginine dibasic convertase, a metalloendopeptidase as a prototype of a class of processing enzymes."
      Pierotti A.R., Prat A., Chesneau V., Gaudoux F., Leseney A.-M., Foulon T., Cohen P.
      Proc. Natl. Acad. Sci. U.S.A. 91:6078-6082(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Testis.
    2. "Human and rat testis express two mRNA species encoding variants of NRD convertase, a metalloendopeptidase of the insulinase family."
      Hospital V., Prat A., Joulie C., Cherif D., Day R., Cohen P.
      Biochem. J. 327:773-779(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Testis.
    3. "N-arginine dibasic convertase (NRD convertase): a newcomer to the family of processing endopeptidases. An overview."
      Chesneau V., Pierotti A.R., Prat A., Gaudoux F., Foulon T., Cohen P.
      Biochimie 76:234-240(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISCUSSION OF SEQUENCE.

    Entry informationi

    Entry nameiNRDC_RAT
    AccessioniPrimary (citable) accession number: P47245
    Secondary accession number(s): O35836
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1996
    Last sequence update: February 1, 1996
    Last modified: October 1, 2014
    This is version 108 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Peptidase families
      Classification of peptidase families and list of entries
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3