SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P47245

- NRDC_RAT

UniProt

P47245 - NRDC_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Nardilysin
Gene
Nrd1, Nrdc
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

Catalytic activityi

Hydrolysis of polypeptides, preferably at -Xaa-|-Arg-Lys-, and less commonly at -Arg-|-Arg-Xaa-, in which Xaa is not Arg or Lys.

Cofactori

Binds 1 zinc ion per subunit By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi244 – 2441Zinc By similarity
Active sitei247 – 2471Proton acceptor By similarity
Metal bindingi248 – 2481Zinc By similarity
Metal bindingi325 – 3251Zinc By similarity

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. metalloendopeptidase activity Source: InterPro
  3. peptidase activity Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM16.005.

Names & Taxonomyi

Protein namesi
Recommended name:
Nardilysin (EC:3.4.24.61)
Alternative name(s):
N-arginine dibasic convertase
Short name:
NRD convertase
Short name:
NRD-C
Gene namesi
Name:Nrd1
Synonyms:Nrdc
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi3210. Nrd1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1818 Reviewed prediction
Add
BLAST
Chaini19 – 11611143Nardilysin
PRO_0000026757Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei85 – 851Phosphoserine By similarity
Modified residuei91 – 911Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP47245.
PRIDEiP47245.

PTM databases

PhosphoSiteiP47245.

Expressioni

Tissue specificityi

Testis, and in a lower level in brain, heart and adrenal glands.

Gene expression databases

GenevestigatoriP47245.

Structurei

3D structure databases

ProteinModelPortaliP47245.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi139 – 20971Asp/Glu-rich (highly acidic)
Add
BLAST
Compositional biasi140 – 15920Poly-Glu
Add
BLAST
Compositional biasi160 – 1689Poly-Asp
Compositional biasi193 – 1986Poly-Asp

Sequence similaritiesi

Belongs to the peptidase M16 family.

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG1025.
HOGENOMiHOG000231160.
HOVERGENiHBG006530.
KOiK01411.
PhylomeDBiP47245.

Family and domain databases

Gene3Di3.30.830.10. 5 hits.
InterProiIPR011249. Metalloenz_LuxS/M16.
IPR011237. Pept_M16_dom.
IPR011765. Pept_M16_N.
IPR001431. Pept_M16_Zn_BS.
IPR007863. Peptidase_M16_C.
[Graphical view]
PfamiPF00675. Peptidase_M16. 1 hit.
PF05193. Peptidase_M16_C. 2 hits.
[Graphical view]
SUPFAMiSSF63411. SSF63411. 5 hits.
PROSITEiPS00143. INSULINASE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P47245-1) [UniParc]FASTAAdd to Basket

Also known as: NRD1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLRRVAVAAV FATGRKLRCE AGRDVTAVGR IEARGLCEES AKPFPTLTMP     50
GRNKAKSTCS CPDLQPNGQD LGESGRVARL GADESEEEGR SLSNVGDPEI 100
IKSPSDPKQY RYIKLQNGLQ ALLISDLSNV EGKTGNATDE EEEEEEEEEE 150
GEEEEEEEED DDDDDDEDSG AEIQDDDEEG FDDEEEFDDD EHDDDDLDNE 200
ENELEELEER VEARKKTTEK QSAAALCVGV GSFADPDDLP GLAHFLEHMV 250
FMGSLKYPDE NGFDAFLKKH GGSDNASTDC ERTVFQFDVQ RKYFKEALDR 300
WAQFFIHPLM IRDAIDREVE AVDSEYQLAR PSDANRKEML FGSLARPGHP 350
MGKFFWGNAE TLKHEPKKNN IDTHARLREF WMRYYSAHYM TLVVQSKETL 400
DTLEKWVTEI FSQIPNNGLP KPNFSHLTDP FDTPAFNKLY RVVPIRKIHA 450
LTITWALPPQ QQHYRVKPLH YISWLVGHEG KGSILSYLRK KCWALALFGG 500
NGETGFEQNS TYSVFSISIT LTDEGYEHFY EVAHTVFQYL KMLQKLGPEK 550
RVFEEIQKIE DNEFHYQEQT DPVEYVENMC ENMQLYPRQD FLTGDQLLFE 600
YKPEVIAEAL NQLVPQKANL VLLSGANEGR CDLKEKWFGT QYSIEDIENS 650
WTELWKSNFD LNSDLHLPAE NKYIATDFTL KAFDCPETEY PAKIVNTPQG 700
CLWYKKDNKF KIPKAYIRFH LISPLIQKSA ANVVLFDIFV NILTHNLAEP 750
AYEADVAQLE YKLVAGEHGL IIRVKGFNHK LPLLFQLIID YLTEFSSTPA 800
VFTMITEQLK KTYFNILIKP ETLAKDVRLL ILEYSRWSMI DKYRALMDGL 850
SLESLLNFVK DFKSQLFVEG LVQGNVTSTE SMDFLRYVVD KLNFVPLERE 900
MPVQFQVVEL PSGHHLCKVR ALNKGDANSE VTVYYQSGTR SLREYTLMEL 950
LVMHMEEPCF DFLRTKQTLG YHVYPTCRNT SGILGFSVTV GTQATKYNSE 1000
TVDKKIEEFL SSFEEKIENL TEDAFNTQVT ALIKLKECED THLGEEVDRN 1050
WNEVVTQQYL FDRLAHEIEA LKSFSKSDLV SWFKAHRGPG SKMLSVHVVG 1100
YGKYELEEDG APVCEDPNSR EGMQLIYLPP SPLLAESTTP ITDIRAFTAT 1150
LSLFPYHKIV K 1161
Length:1,161
Mass (Da):132,976
Last modified:February 1, 1996 - v1
Checksum:i64A0CCEFB29386BB
GO
Isoform 2 (identifier: P47245-2) [UniParc]FASTAAdd to Basket

Also known as: NRD2

The sequence of this isoform differs from the canonical sequence as follows:
     221-221: Q → QQSQNLFLLWSKLTDRLWFKSSYSKMSSTLLVETRNLYGVVGAESRSAPVEHLAGWQVEEQQGETDTVL

Show »
Length:1,229
Mass (Da):140,704
Checksum:i36298E4D7ED71F4E
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei221 – 2211Q → QQSQNLFLLWSKLTDRLWFK SSYSKMSSTLLVETRNLYGV VGAESRSAPVEHLAGWQVEE QQGETDTVL in isoform 2.
VSP_007115

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L27124 mRNA. Translation: AAA21818.1.
X93208 mRNA. Translation: CAA63696.1.
PIRiI59311.
RefSeqiNP_037125.1. NM_012993.2. [P47245-1]
UniGeneiRn.203027.

Genome annotation databases

GeneIDi25499.
KEGGirno:25499.
UCSCiRGD:3210. rat. [P47245-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L27124 mRNA. Translation: AAA21818.1 .
X93208 mRNA. Translation: CAA63696.1 .
PIRi I59311.
RefSeqi NP_037125.1. NM_012993.2. [P47245-1 ]
UniGenei Rn.203027.

3D structure databases

ProteinModelPortali P47245.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

MEROPSi M16.005.

PTM databases

PhosphoSitei P47245.

Proteomic databases

PaxDbi P47245.
PRIDEi P47245.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 25499.
KEGGi rno:25499.
UCSCi RGD:3210. rat. [P47245-1 ]

Organism-specific databases

CTDi 4898.
RGDi 3210. Nrd1.

Phylogenomic databases

eggNOGi COG1025.
HOGENOMi HOG000231160.
HOVERGENi HBG006530.
KOi K01411.
PhylomeDBi P47245.

Miscellaneous databases

NextBioi 606901.
PROi P47245.

Gene expression databases

Genevestigatori P47245.

Family and domain databases

Gene3Di 3.30.830.10. 5 hits.
InterProi IPR011249. Metalloenz_LuxS/M16.
IPR011237. Pept_M16_dom.
IPR011765. Pept_M16_N.
IPR001431. Pept_M16_Zn_BS.
IPR007863. Peptidase_M16_C.
[Graphical view ]
Pfami PF00675. Peptidase_M16. 1 hit.
PF05193. Peptidase_M16_C. 2 hits.
[Graphical view ]
SUPFAMi SSF63411. SSF63411. 5 hits.
PROSITEi PS00143. INSULINASE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "N-arginine dibasic convertase, a metalloendopeptidase as a prototype of a class of processing enzymes."
    Pierotti A.R., Prat A., Chesneau V., Gaudoux F., Leseney A.-M., Foulon T., Cohen P.
    Proc. Natl. Acad. Sci. U.S.A. 91:6078-6082(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. "Human and rat testis express two mRNA species encoding variants of NRD convertase, a metalloendopeptidase of the insulinase family."
    Hospital V., Prat A., Joulie C., Cherif D., Day R., Cohen P.
    Biochem. J. 327:773-779(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Testis.
  3. "N-arginine dibasic convertase (NRD convertase): a newcomer to the family of processing endopeptidases. An overview."
    Chesneau V., Pierotti A.R., Prat A., Gaudoux F., Foulon T., Cohen P.
    Biochimie 76:234-240(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISCUSSION OF SEQUENCE.

Entry informationi

Entry nameiNRDC_RAT
AccessioniPrimary (citable) accession number: P47245
Secondary accession number(s): O35836
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: February 1, 1996
Last modified: May 14, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi