SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P46737

- BRCC3_MOUSE

UniProt

P46737 - BRCC3_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Lys-63-specific deubiquitinase BRCC36

Gene
Brcc3, Brcc36, C6.1a
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not have activity toward 'Lys-48'-linked polyubiquitin chains. Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). In the BRCA1-A complex, it specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX, antagonizing the RNF8-dependent ubiquitination at double-strand breaks (DSBs). Catalytic subunit of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates. Mediates the specific 'Lys-63'-specific deubiquitination associated with the COP9 signalosome complex (CSN), via the interaction of the BRISC complex with the CSN complex By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi122 – 1221Zinc; catalytic By similarity
Metal bindingi124 – 1241Zinc; catalytic By similarity
Metal bindingi135 – 1351Zinc; catalytic By similarity

GO - Molecular functioni

  1. enzyme regulator activity Source: Ensembl
  2. metal ion binding Source: UniProtKB-KW
  3. metallopeptidase activity Source: UniProtKB
  4. polyubiquitin binding Source: UniProtKB
  5. protein binding Source: MGI
  6. ubiquitin-specific protease activity Source: UniProtKB
  7. ubiquitin thiolesterase activity Source: UniProtKB

GO - Biological processi

  1. double-strand break repair Source: UniProtKB
  2. G2 DNA damage checkpoint Source: UniProtKB
  3. histone H2A K63-linked deubiquitination Source: UniProtKB
  4. positive regulation of DNA repair Source: UniProtKB
  5. protein K63-linked deubiquitination Source: UniProtKB
  6. response to ionizing radiation Source: UniProtKB
  7. response to X-ray Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator, Hydrolase, Metalloprotease, Protease

Keywords - Biological processi

DNA damage, DNA repair, Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM67.004.

Names & Taxonomyi

Protein namesi
Recommended name:
Lys-63-specific deubiquitinase BRCC36 (EC:3.4.19.-)
Alternative name(s):
BRCA1-A complex subunit BRCC36
BRCA1/BRCA2-containing complex subunit 3
BRCA1/BRCA2-containing complex subunit 36
BRISC complex subunit BRCC36
Gene namesi
Name:Brcc3
Synonyms:Brcc36, C6.1a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome X

Organism-specific databases

MGIiMGI:2389572. Brcc3.

Subcellular locationi

Nucleus By similarity
Note: Localizes at sites of DNA damage at double-strand breaks (DSBs) By similarity.

GO - Cellular componenti

  1. BRCA1-A complex Source: UniProtKB
  2. BRISC complex Source: UniProtKB
  3. nuclear ubiquitin ligase complex Source: Ensembl
  4. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed By similarity
Chaini2 – 291290Lys-63-specific deubiquitinase BRCC36PRO_0000213968Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine By similarity

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiP46737.
PaxDbiP46737.
PRIDEiP46737.

PTM databases

PhosphoSiteiP46737.

Expressioni

Gene expression databases

ArrayExpressiP46737.
BgeeiP46737.
CleanExiMM_BRCC3.
GenevestigatoriP46737.

Interactioni

Subunit structurei

Component of the BRCA1-A complex, at least composed of the BRCA1, BARD1, UIMC1/RAP80, FAM175A/Abraxas, BRCC3/BRCC36, BRE/BRCC45 and BABAM1/NBA1. In the BRCA1-A complex, interacts directly with FAM175A/Abraxas and BRE/BRCC45. Component of the BRISC complex, at least composed of the FAM175B/ABRO1, BRCC3/BRCC36, BRE/BRCC45 and BABAM1/NBA1. The BRISC complex interacts with the CSN complex. Component of the BRCA1/BRCA2 containing complex (BRCC), which also contains BRCA1, BRCA2, BARD1, BRE and RAD51. BRCC is a ubiquitin E3 ligase complex that enhances cellular survival following DNA damage. Interacts with BRCA1. Binds polyubiquitin By similarity.

Protein-protein interaction databases

BioGridi229180. 1 interaction.
IntActiP46737. 2 interactions.
MINTiMINT-4089567.

Structurei

3D structure databases

ProteinModelPortaliP46737.
SMRiP46737. Positions 9-215.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini7 – 148142MPNAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi122 – 13514JAMM motifAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG322509.
GeneTreeiENSGT00390000000360.
HOGENOMiHOG000007866.
HOVERGENiHBG002142.
InParanoidiQ3UDZ4.
KOiK11864.
OMAiDAFLVCM.
OrthoDBiEOG7KM5TH.
PhylomeDBiP46737.
TreeFamiTF328524.

Family and domain databases

InterProiIPR000555. JAMM/MPN+_dom.
[Graphical view]
PfamiPF01398. JAB. 1 hit.
[Graphical view]
SMARTiSM00232. JAB_MPN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P46737-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAVQVVQAVQ AVHLESDAFL VCLNHALSTE KEEVMGLCIG ELNDDIRSDS    50
KFTYTGTEMR TVQEKMDTIR IVHIHSVIIL RRSDKRKDRV EISPEQLSAA 100
STEAERLAEL TGRPMRVVGW YHSHPHITVW PSHVDVRTQA MYQMMDQGFV 150
GLIFSCFIED KNTKTGRVLY TCFQSIQAQK SSEYERIEIP IHIVPHITIG 200
KVCLESAVEL PKILCQEEQD AYRRIHSLTH LDSVTKIHNG SVFTKNLCSQ 250
MSAVSGPLLQ WLEDRLEQNQ QHLQELQQEK EELMEELSSL E 291
Length:291
Mass (Da):33,340
Last modified:November 1, 1995 - v1
Checksum:i82D18B79D8EC5F72
GO
Isoform 2 (identifier: P46737-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-227: EYERIEIPIHIVPHITIGKVCLESAVELPKILCQEEQDAYRRIHS → D

Show »
Length:247
Mass (Da):28,203
Checksum:i6FEF9E1B6BC8DA73
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei183 – 22745EYERI…RRIHS → D in isoform 2. VSP_037260Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti108 – 1081A → S in BAE29117. 1 Publication
Sequence conflicti201 – 2011K → E in BAE29117. 1 Publication
Sequence conflicti280 – 2801K → R in BAB27894. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
S68022 mRNA. Translation: AAB29006.2.
AK011876 mRNA. Translation: BAB27894.1.
AK149844 mRNA. Translation: BAE29117.1.
AL671860 Genomic DNA. Translation: CAM46071.1.
AL671860 Genomic DNA. Translation: CAP19082.1.
BC021313 mRNA. Translation: AAH21313.1.
BC048179 mRNA. Translation: AAH48179.1.
CCDSiCCDS41031.1. [P46737-1]
RefSeqiNP_001159929.1. NM_001166457.1. [P46737-1]
NP_001159931.1. NM_001166459.1. [P46737-1]
NP_666068.1. NM_145956.4. [P46737-1]
UniGeneiMm.226957.

Genome annotation databases

EnsembliENSMUST00000033544; ENSMUSP00000033544; ENSMUSG00000031201. [P46737-1]
ENSMUST00000114074; ENSMUSP00000109708; ENSMUSG00000031201. [P46737-1]
ENSMUST00000118428; ENSMUSP00000114057; ENSMUSG00000031201. [P46737-2]
GeneIDi210766.
KEGGimmu:210766.
UCSCiuc009tpy.2. mouse. [P46737-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
S68022 mRNA. Translation: AAB29006.2 .
AK011876 mRNA. Translation: BAB27894.1 .
AK149844 mRNA. Translation: BAE29117.1 .
AL671860 Genomic DNA. Translation: CAM46071.1 .
AL671860 Genomic DNA. Translation: CAP19082.1 .
BC021313 mRNA. Translation: AAH21313.1 .
BC048179 mRNA. Translation: AAH48179.1 .
CCDSi CCDS41031.1. [P46737-1 ]
RefSeqi NP_001159929.1. NM_001166457.1. [P46737-1 ]
NP_001159931.1. NM_001166459.1. [P46737-1 ]
NP_666068.1. NM_145956.4. [P46737-1 ]
UniGenei Mm.226957.

3D structure databases

ProteinModelPortali P46737.
SMRi P46737. Positions 9-215.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 229180. 1 interaction.
IntActi P46737. 2 interactions.
MINTi MINT-4089567.

Protein family/group databases

MEROPSi M67.004.

PTM databases

PhosphoSitei P46737.

Proteomic databases

MaxQBi P46737.
PaxDbi P46737.
PRIDEi P46737.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000033544 ; ENSMUSP00000033544 ; ENSMUSG00000031201 . [P46737-1 ]
ENSMUST00000114074 ; ENSMUSP00000109708 ; ENSMUSG00000031201 . [P46737-1 ]
ENSMUST00000118428 ; ENSMUSP00000114057 ; ENSMUSG00000031201 . [P46737-2 ]
GeneIDi 210766.
KEGGi mmu:210766.
UCSCi uc009tpy.2. mouse. [P46737-1 ]

Organism-specific databases

CTDi 79184.
MGIi MGI:2389572. Brcc3.

Phylogenomic databases

eggNOGi NOG322509.
GeneTreei ENSGT00390000000360.
HOGENOMi HOG000007866.
HOVERGENi HBG002142.
InParanoidi Q3UDZ4.
KOi K11864.
OMAi DAFLVCM.
OrthoDBi EOG7KM5TH.
PhylomeDBi P46737.
TreeFami TF328524.

Miscellaneous databases

NextBioi 373053.
PROi P46737.
SOURCEi Search...

Gene expression databases

ArrayExpressi P46737.
Bgeei P46737.
CleanExi MM_BRCC3.
Genevestigatori P46737.

Family and domain databases

InterProi IPR000555. JAMM/MPN+_dom.
[Graphical view ]
Pfami PF01398. JAB. 1 hit.
[Graphical view ]
SMARTi SM00232. JAB_MPN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The chromosomal translocation t(X;14)(q28;q11) in T-cell pro-lymphocytic leukaemia breaks within one gene and activates another."
    Fisch P., Forster A., Sherrington P.D., Dyer M.J.S., Rabbitts T.H.
    Oncogene 8:3271-3276(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Embryo.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Bone marrow and Embryo.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6.
    Tissue: Brain and Mammary tumor.

Entry informationi

Entry nameiBRCC3_MOUSE
AccessioniPrimary (citable) accession number: P46737
Secondary accession number(s): A3KGA9
, A8Y5K0, Q3UDZ4, Q9D025
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: July 9, 2014
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi