Reviewed,
UniProtKB/Swiss-Prot P46737 (BRCC3_MOUSE)
Last modified
November 3, 2009.
Version 72.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Lys-63-specific deubiquitinase BRCC36 EC=3.1.2.15 Alternative name(s): BRCA1-A complex subunit BRCC36 BRISC complex subunit BRCC36 BRCA1/BRCA2-containing complex subunit 3 BRCA1/BRCA2-containing complex subunit 36 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 291 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not have activity toward 'Lys-48'-linked polyubiquitin chains. Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). In the BRCA1-A complex, it specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX, antagonizing the RNF8-dependent ubiquitination at double-strand breaks (DSBs). Catalytic subunit of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates. Mediates the specific 'Lys-63'-specific deubiquitination associated with the COP9 signalosome complex (CSN), via the interaction of the BRISC complex with the CSN complex By similarity. |
| Catalytic activity | Ubiquitin C-terminal thioester + H2O = ubiquitin + a thiol. |
| Subunit structure | Component of the BRCA1-A complex, at least composed of the BRCA1, BARD1, UIMC1/RAP80, FAM175A/Abraxas, BRCC3/BRCC36, BRE/BRCC45 and MERIT40/NBA1. In the BRCA1-A complex, interacts directly with FAM175A/Abraxas and BRE/BRCC45. Component of the BRISC complex, at least composed of the FAM175B/ABRO1, BRCC3/BRCC36, BRE/BRCC45 and MERIT40/NBA1. The BRISC complex interacts with the CSN complex. Component of the BRCA1/BRCA2 containing complex (BRCC), which also contains BRCA1, BRCA2, BARD1, BRE and RAD51. BRCC is a ubiquitin E3 ligase complex that enhances cellular survival following DNA damage. Interacts with BRCA1. Binds polyubiquitin By similarity. |
| Subcellular location | Nucleus By similarity. Note: Localizes at sites of DNA damage at double-strand breaks (DSBs) By similarity. |
| Sequence similarities | Belongs to the peptidase M67A family. BRCC36 subfamily. Contains 1 MPN (JAB/Mov34) domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P46737-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P46737-2) The sequence of this isoform differs from the canonical sequence as follows: 183-227: EYERIEIPIHIVPHITIGKVCLESAVELPKILCQEEQDAYRRIHS → D |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 291 | 290 | Lys-63-specific deubiquitinase BRCC36 | PRO_0000213968 | |||||
Regions | |||||||||
| Motif | 122 – 135 | 14 | JAMM motif | ||||||
Sites | |||||||||
| Metal binding | 122 | 1 | Zinc; catalytic By similarity | ||||||
| Metal binding | 124 | 1 | Zinc; catalytic By similarity | ||||||
| Metal binding | 135 | 1 | Zinc; catalytic By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 183 – 227 | 45 | EYERI…RRIHS → D in isoform 2. | VSP_037260 | |||||
Experimental info | |||||||||
| Sequence conflict | 108 | 1 | A → S in BAE29117. Ref.2 | ||||||
| Sequence conflict | 201 | 1 | K → E in BAE29117. Ref.2 | ||||||
| Sequence conflict | 280 | 1 | K → R in BAB27894. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The chromosomal translocation t(X;14)(q28;q11) in T-cell pro-lymphocytic leukaemia breaks within one gene and activates another." Fisch P., Forster A., Sherrington P.D., Dyer M.J.S., Rabbitts T.H. Oncogene 8:3271-3276(1993) [PubMed: 8247530] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Embryo. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Bone marrow and Embryo. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1 AND 2). Strain: C57BL/6J. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6. Tissue: Brain and Mammary tumor. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| S68022 mRNA. Translation: AAB29006.2. AK011876 mRNA. Translation: BAB27894.1. AK149844 mRNA. Translation: BAE29117.1. AL671860 Genomic DNA. Translation: CAM46071.1. AL671860 Genomic DNA. Translation: CAP19082.1. BC021313 mRNA. Translation: AAH21313.1. BC048179 mRNA. Translation: AAH48179.1. | |
| IPI | IPI00137103. IPI00880818. |
| RefSeq | NP_666068.1. |
| UniGene | Mm.226957 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P46737. |
PTM databases | |
| PhosphoSite | P46737. |
Proteomic databases | |
| PRIDE | P46737. |
Genome annotation databases | |
| Ensembl | ENSMUST00000033544; ENSMUSP00000033544; ENSMUSG00000031201; Mus musculus. [Genome view] ENSMUST00000114074; ENSMUSP00000109708; ENSMUSG00000031201; Mus musculus. [Genome view] ENSMUST00000114075; ENSMUSP00000109709; ENSMUSG00000031201; Mus musculus. [Genome view] ENSMUST00000116565; ENSMUSP00000112264; ENSMUSG00000031201; Mus musculus. [Genome view] |
| GeneID | 210766. |
| KEGG | mmu:210766. |
| UCSC | uc009tpy.1. mouse. |
Organism-specific databases | |
| CTD | 210766. |
| MGI | MGI:2389572. Brcc3. |
Phylogenomic databases | |
| HOGENOM | P46737. |
| HOVERGEN | P46737. |
| OMA | GTEMRTV. |
Gene expression databases | |
| ArrayExpress | P46737. |
| Bgee | P46737. |
| CleanEx | MM_BRCC3. |
| Genevestigator | P46737. |
| GermOnline | ENSMUSG00000031201. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000555. Mov34_MPN_PAD1. [Graphical view] |
| Pfam | PF01398. Mov34. 1 hit. [Graphical view] |
| SMART | SM00232. JAB_MPN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 373053. |
| SOURCE | Search... |
Entry information
| Entry name | BRCC3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P46737 Secondary accession number(s): A3KGA9 Q9D025 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


