P46736 (BRCC3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 124.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Lys-63-specific deubiquitinase BRCC36 EC=3.4.19.- Alternative name(s): BRCA1-A complex subunit BRCC36 BRCA1/BRCA2-containing complex subunit 3 BRCA1/BRCA2-containing complex subunit 36 BRISC complex subunit BRCC36 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 316 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not have activity toward 'Lys-48'-linked polyubiquitin chains. Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). In the BRCA1-A complex, it specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX, antagonizing the RNF8-dependent ubiquitination at double-strand breaks (DSBs). Catalytic subunit of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates. Mediates the specific 'Lys-63'-specific deubiquitination associated with the COP9 signalosome complex (CSN), via the interaction of the BRISC complex with the CSN complex. Ref.3 Ref.8 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 Ref.15 |
| Subunit structure | Component of the BRCA1-A complex, at least composed of the BRCA1, BARD1, UIMC1/RAP80, FAM175A/Abraxas, BRCC3/BRCC36, BRE/BRCC45 and BABAM1/NBA1. In the BRCA1-A complex, interacts directly with FAM175A/Abraxas and BRE/BRCC45. Component of the BRISC complex, at least composed of the FAM175B/ABRO1, BRCC3/BRCC36, BRE/BRCC45 and BABAM1/NBA1. The BRISC complex interacts with the CSN complex. Component of the BRCA1/BRCA2 containing complex (BRCC), which also contains BRCA1, BRCA2, BARD1, BRE and RAD51. BRCC is a ubiquitin E3 ligase complex that enhances cellular survival following DNA damage. Interacts with BRCA1. Binds polyubiquitin. Ref.3 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 |
| Subcellular location | Nucleus. Note: Localizes at sites of DNA damage at double-strand breaks (DSBs). Ref.9 Ref.11 Ref.13 Ref.15 |
| Tissue specificity | Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Aberrantly expressed in the vast majority of breast tumors. Ref.8 |
| Involvement in disease | A chromosomal aberration involving BRCC3 is a cause of pro-lymphocytic T-cell leukemia (T-PLL). Translocation t(X;14)(q28;q11) with TCRA. |
| Sequence similarities | Belongs to the peptidase M67A family. BRCC36 subfamily. Contains 1 MPN (JAB/Mov34) domain. |
| Sequence caution | The sequence AAB29005.2 differs from that shown. Reason: Erroneous initiation. The sequence CAO03573.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: P46736-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P46736-2) The sequence of this isoform differs from the canonical sequence as follows: 184-208: Missing. | ||||||
| Isoform 3 (identifier: P46736-3) The sequence of this isoform differs from the canonical sequence as follows: 46-46: T → TS 184-208: Missing. | ||||||
| Isoform 4 (identifier: P46736-4) The sequence of this isoform differs from the canonical sequence as follows: 1-114: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: P46736-5) The sequence of this isoform differs from the canonical sequence as follows: 183-252: ESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHS → D | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.7 | ||||||
| Chain | 2 – 316 | 315 | Lys-63-specific deubiquitinase BRCC36 | PRO_0000213967 | |||||
Regions | |||||||||
| Domain | 7 – 148 | 142 | MPN | ||||||
| Motif | 122 – 135 | 14 | JAMM motif | ||||||
Sites | |||||||||
| Metal binding | 122 | 1 | Zinc; catalytic Probable | ||||||
| Metal binding | 124 | 1 | Zinc; catalytic Probable | ||||||
| Metal binding | 135 | 1 | Zinc; catalytic By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 114 | 114 | Missing in isoform 4. | VSP_037257 | |||||
| Alternative sequence | 46 | 1 | T → TS in isoform 3. | VSP_037258 | |||||
| Alternative sequence | 183 – 252 | 70 | ESLHG…RRIHS → D in isoform 5. | VSP_037259 | |||||
| Alternative sequence | 184 – 208 | 25 | Missing in isoform 1 and isoform 3. | VSP_003261 | |||||
| Natural variant | 74 | 1 | I → V. Corresponds to variant rs28997578 [ dbSNP | Ensembl ]. | VAR_050097 | |||||
Experimental info | |||||||||
| Mutagenesis | 122 – 124 | 3 | HSH → QSQ: Abolishes metalloprotease activity and function in DNA repair. Ref.10 Ref.12 Ref.14 Ref.15 | ||||||
| Mutagenesis | 122 | 1 | H → Q: Loss of deubiquitinase activity. Ref.14 | ||||||
| Sequence conflict | 225 | 1 | G → W in AAB29005. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and sequence of two genes associated with a CpG island 5' of the factor VIII gene." Kenwrick S., Levinson B., Taylor S., Shapiro A., Gitschier J. Hum. Mol. Genet. 1:179-186(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [2] | "The chromosomal translocation t(X;14)(q28;q11) in T-cell pro-lymphocytic leukaemia breaks within one gene and activates another." Fisch P., Forster A., Sherrington P.D., Dyer M.J.S., Rabbitts T.H. Oncogene 8:3271-3276(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHROMOSOMAL TRANSLOCATION. |
| [3] | "Regulation of BRCC, a holoenzyme complex containing BRCA1 and BRCA2, by a signalosome-like subunit and its role in DNA repair." Dong Y., Hakimi M.-A., Chen X., Kumaraswamy E., Cooch N.S., Godwin A.K., Shiekhattar R. Mol. Cell 12:1087-1099(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, IDENTIFICATION IN BRCC COMPLEX, INTERACTION WITH BRCA1. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4). Tissue: Brain and Teratocarcinoma. |
| [5] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lung. |
| [7] | Bienvenut W.V., Waridel P., Quadroni M. Submitted (MAR-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-31; 90-106 AND 227-237, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [8] | "BRCC36 is essential for ionizing radiation-induced BRCA1 phosphorylation and nuclear foci formation." Chen X., Arciero C.A., Wang C., Broccoli D., Godwin A.K. Cancer Res. 66:5039-5046(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [9] | "Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage." Wang B., Elledge S.J. Proc. Natl. Acad. Sci. U.S.A. 104:20759-20763(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE BRCA1-A COMPLEX, SUBCELLULAR LOCATION, INTERACTION WITH FAM175A. |
| [10] | "RAP80 targets BRCA1 to specific ubiquitin structures at DNA damage sites." Sobhian B., Shao G., Lilli D.R., Culhane A.C., Moreau L.A., Xia B., Livingston D.M., Greenberg R.A. Science 316:1198-1202(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN THE BRCA1-A COMPLEX, MUTAGENESIS OF 122-HIS--HIS-124. |
| [11] | "NBA1, a new player in the Brca1 A complex, is required for DNA damage resistance and checkpoint control." Wang B., Hurov K., Hofmann K., Elledge S.J. Genes Dev. 23:729-739(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN THE BRCA1-A COMPLEX, SUBCELLULAR LOCATION, UBIQUITIN-BINDING, INTERACTION WITH FAM175A. |
| [12] | "MERIT40 controls BRCA1-Rap80 complex integrity and recruitment to DNA double-strand breaks." Shao G., Patterson-Fortin J., Messick T.E., Feng D., Shanbhag N., Wang Y., Greenberg R.A. Genes Dev. 23:740-754(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE BRCA1-A COMPLEX, MUTAGENESIS OF 122-HIS--HIS-124. |
| [13] | "MERIT40 facilitates BRCA1 localization and DNA damage repair." Feng L., Huang J., Chen J. Genes Dev. 23:719-728(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE BRCA1-A COMPLEX, SUBCELLULAR LOCATION, INTERACTION WITH BRE AND FAM175A. |
| [14] | "K63-specific deubiquitination by two JAMM/MPN+ complexes: BRISC-associated Brcc36 and proteasomal Poh1." Cooper E.M., Cutcliffe C., Kristiansen T.Z., Pandey A., Pickart C.M., Cohen R.E. EMBO J. 28:621-631(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, IDENTIFICATION IN THE BRISC COMPLEX, INTERACTION WITH THE CSN COMPLEX, MUTAGENESIS OF HIS-122. |
| [15] | "The Rap80-BRCC36 de-ubiquitinating enzyme complex antagonizes RNF8-Ubc13-dependent ubiquitination events at DNA double strand breaks." Shao G., Lilli D.R., Patterson-Fortin J., Coleman K.A., Morrissey D.E., Greenberg R.A. Proc. Natl. Acad. Sci. U.S.A. 106:3166-3171(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF 122-HIS--HIS-124. |
| [16] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X64643 mRNA. Translation: CAA45917.1. S68015 mRNA. Translation: AAB29005.2. Different initiation. AY438030 mRNA. Translation: AAR30498.1. AK298886 mRNA. Translation: BAG60999.1. AK299194 mRNA. Translation: BAG61237.1. AK313544 mRNA. Translation: BAG36320.1. BX293995, BX470111 Genomic DNA. Translation: CAH70537.1. BX293995, BX470111 Genomic DNA. Translation: CAH70538.1. BX470111, BX293995 Genomic DNA. Translation: CAI41654.1. BX470111, BX293995 Genomic DNA. Translation: CAI41655.1. BX470111 Genomic DNA. Translation: CAO03573.1. Sequence problems. BX470111 Genomic DNA. Translation: CAO03574.1. BX470111, BX293995 Genomic DNA. Translation: CAO03575.1. BX470111, BX293995 Genomic DNA. Translation: CAO03576.1. BX293995, BX470111 Genomic DNA. Translation: CAO03601.1. BX293995, BX470111 Genomic DNA. Translation: CAO03602.1. BC002999 mRNA. Translation: AAH02999.1. BC006540 mRNA. Translation: AAH06540.1. |
| IPI | IPI00853631. IPI00871617. IPI00936224. IPI00939471. IPI01010909. |
| PIR | I38167. |
| RefSeq | NP_001018065.1. NM_001018055.2. NP_001229569.1. NM_001242640.1. NP_077308.1. NM_024332.3. |
| UniGene | Hs.558537. |
3D structure databases | |
| ProteinModelPortal | P46736. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-48719N. |
| IntAct | P46736. 20 interactions. |
| MINT | MINT-1475401. |
Protein family/group databases | |
| MEROPS | M67.004. |
PTM databases | |
| PhosphoSite | P46736. |
Polymorphism databases | |
| DMDM | 20532383. |
Proteomic databases | |
| PaxDb | P46736. |
| PRIDE | P46736. |
Protocols and materials databases | |
| DNASU | 79184. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000330045; ENSP00000328641; ENSG00000185515. ENST00000340647; ENSP00000344103; ENSG00000185515. ENST00000369459; ENSP00000358471; ENSG00000185515. ENST00000369462; ENSP00000358474; ENSG00000185515. ENST00000399026; ENSP00000381988; ENSG00000185515. ENST00000411985; ENSP00000413170; ENSG00000185515. ENST00000594541; ENSP00000470674; ENSG00000269884. ENST00000596060; ENSP00000471044; ENSG00000269884. ENST00000597217; ENSP00000469831; ENSG00000269884. ENST00000597826; ENSP00000473083; ENSG00000269884. ENST00000600398; ENSP00000472343; ENSG00000269884. ENST00000601378; ENSP00000469902; ENSG00000269884. |
| GeneID | 79184. |
| KEGG | hsa:79184. |
| UCSC | uc004fna.3. human. uc004fnb.3. human. uc011mzy.2. human. |
Organism-specific databases | |
| CTD | 79184. |
| GeneCards | GC0XP154299. |
| HGNC | HGNC:24185. BRCC3. |
| MIM | 300617. gene. |
| neXtProt | NX_P46736. |
| Orphanet | 280679. Moyamoya disease - short stature - facial dysmorphism - hypergonadotropic hypogonadism. |
| PharmGKB | PA134922847. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG322509. |
| HOVERGEN | HBG002142. |
| KO | K11864. |
Gene expression databases | |
| ArrayExpress | P46736. |
| Bgee | P46736. |
| CleanEx | HS_BRCC3. |
| Genevestigator | P46736. |
| GermOnline | ENSG00000185515. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000555. JAB1_Mov34_MPN_PAD1. [Graphical view] |
| Pfam | PF01398. JAB. 1 hit. [Graphical view] |
| SMART | SM00232. JAB_MPN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 79184. |
| NextBio | 68176. |
| SOURCE | Search... |
Entry information
| Entry name | BRCC3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P46736 Secondary accession number(s): A6QRF8 Q9BTZ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
