P46518 LEA14_GOSHI Late embryogenesis abundant protein Lea14-A LEA14-A Gossypium hirsutum Upland cotton Gossypium mexicanum Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliophyta eudicotyledons core eudicotyledons rosids malvids Malvales Malvaceae Malvoideae Gossypium Cotton Lea5 and Lea14 encode atypical late embryogenesis-abundant proteins. NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] cv. Coker 201 Cotyledon By water stress; in leaves. Belongs to the LEA type 2 family. Stress response MSQLLEKAKDFVVDKVANIKKPEASVSDVDLKHVSRECVEYGAKVSVSNPYSHSIPICEI SYNFRSAGRGIASGTIPDPGSLKASDTTMLDVPVKVPYNILVSLVKDIGADWDIDYELEL GLTIDLPIVGNFTIPLSQKGEIKLPTLSDIF Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License