P46428 (GST_ANOGA) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 78.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glutathione S-transferase EC=2.5.1.18 Alternative name(s): GST class-sigma | ||||
| Gene names |
| ||||
| Organism | Anopheles gambiae (African malaria mosquito) [Reference proteome] | ||||
| Taxonomic identifier | 7165 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Nematocera › Culicoidea › Culicidae › Anophelinae › Anopheles › ![]() |
Protein attributes
| Sequence length | 203 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. |
| Catalytic activity | RX + glutathione = HX + R-S-glutathione. |
| Subunit structure | Homodimer By similarity. |
| Sequence similarities | Belongs to the GST superfamily. Sigma family. Contains 1 GST C-terminal domain. Contains 1 GST N-terminal domain. |
| Sequence caution | The sequence AAA29358.1 differs from that shown. Reason: Erroneous initiation. The sequence EAA45010.4 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Molecular function | Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Molecular_function | glutathione transferase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: P46428-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform B (identifier: P46428-2) The sequence of this isoform differs from the canonical sequence as follows: 60-95: KVHQSVAMSRYLANQVGLAGADDWENLMIDTVVDTV → RVHQSLAMCRYVAKQINLAGDNPLEALQIDAIVDTI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 203 | 203 | Glutathione S-transferase | PRO_0000185915 | |||||
Regions | |||||||||
| Domain | 2 – 79 | 78 | GST N-terminal | ||||||
| Domain | 81 – 203 | 123 | GST C-terminal | ||||||
| Region | 50 – 51 | 2 | Glutathione binding By similarity | ||||||
| Region | 63 – 64 | 2 | Glutathione binding By similarity | ||||||
Sites | |||||||||
| Binding site | 8 | 1 | Glutathione By similarity | ||||||
| Binding site | 39 | 1 | Glutathione By similarity | ||||||
| Binding site | 43 | 1 | Glutathione By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 60 – 95 | 36 | KVHQS…VVDTV → RVHQSLAMCRYVAKQINLAG DNPLEALQIDAIVDTI in isoform B. | VSP_029900 | |||||
Experimental info | |||||||||
| Sequence conflict | 49 | 1 | G → R in AAA29358. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A glutathione S-transferase gene of the vector mosquito, Anopheles gambiae." Reiss R.A., James A.A. Insect Mol. Biol. 2:25-32(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B). Strain: G3. |
| [2] | "The genome sequence of the malaria mosquito Anopheles gambiae." Holt R.A., Subramanian G.M., Halpern A., Sutton G.G., Charlab R., Nusskern D.R., Wincker P., Clark A.G., Ribeiro J.M.C., Wides R., Salzberg S.L., Loftus B.J., Yandell M.D., Majoros W.H., Rusch D.B., Lai Z., Kraft C.L., Abril J.F. Hoffman S.L.Science 298:129-149(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: PEST. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L07880 mRNA. Translation: AAA29358.1. Different initiation. AAAB01008849 Genomic DNA. Translation: EAA45010.4. Different initiation. |
| RefSeq | XP_311546.4. XM_311546.4. |
3D structure databases | |
| ProteinModelPortal | P46428. |
| SMR | P46428. Positions 4-203. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 7165.AGAP010404-PA. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 1272645. |
| KEGG | aga:AgaP_AGAP010404. |
| VectorBase | AGAP010404. Anopheles gambiae. |
Organism-specific databases | |
| CTD | 1272645. |
Phylogenomic databases | |
| eggNOG | NOG122057. |
| HOGENOM | HOG000115733. |
| InParanoid | P46428. |
| OrthoDB | EOG4N02WZ. |
Family and domain databases | |
| Gene3D | 1.20.1050.10. 1 hit. 3.40.30.10. 1 hit. |
| InterPro | IPR010987. Glutathione-S-Trfase_C-like. IPR004045. Glutathione_S-Trfase_N. IPR017933. Glutathione_S_Trfase/Cl_chnl_C. IPR004046. GST_C. IPR012336. Thioredoxin-like_fold. [Graphical view] |
| Pfam | PF00043. GST_C. 1 hit. PF02798. GST_N. 1 hit. [Graphical view] |
| SUPFAM | SSF47616. GST_C_like. 1 hit. SSF52833. Thiordxn-like_fd. 1 hit. |
| PROSITE | PS50405. GST_CTER. 1 hit. PS50404. GST_NTER. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | GST_ANOGA | ||||||||
| Accession | Primary (citable) accession number: P46428 Secondary accession number(s): Q7PGA2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
