Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P46428 (GST_ANOGA) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 83. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Glutathione S-transferase

EC=2.5.1.18
Alternative name(s):
GST class-sigma
Gene names
Name:GstS1
ORF Names:AGAP010404
OrganismAnopheles gambiae (African malaria mosquito) [Reference proteome]
Taxonomic identifier7165 [NCBI]
Taxonomic lineageEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraNematoceraCulicoideaCulicidaeAnophelinaeAnopheles

Protein attributes

Sequence length203 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Catalytic activity

RX + glutathione = HX + R-S-glutathione.

Subunit structure

Homodimer By similarity.

Sequence similarities

Belongs to the GST superfamily. Sigma family.

Contains 1 GST C-terminal domain.

Contains 1 GST N-terminal domain.

Sequence caution

The sequence AAA29358.1 differs from that shown. Reason: Erroneous initiation.

The sequence EAA45010.4 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   Molecular functionTransferase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Molecular_functionglutathione transferase activity

Inferred from electronic annotation. Source: UniProtKB-EC

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform A (identifier: P46428-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform B (identifier: P46428-2)

The sequence of this isoform differs from the canonical sequence as follows:
     60-95: KVHQSVAMSRYLANQVGLAGADDWENLMIDTVVDTV → RVHQSLAMCRYVAKQINLAGDNPLEALQIDAIVDTI

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 203203Glutathione S-transferase
PRO_0000185915

Regions

Domain2 – 7978GST N-terminal
Domain81 – 203123GST C-terminal
Region50 – 512Glutathione binding By similarity
Region63 – 642Glutathione binding By similarity

Sites

Binding site81Glutathione By similarity
Binding site391Glutathione By similarity
Binding site431Glutathione By similarity

Natural variations

Alternative sequence60 – 9536KVHQS…VVDTV → RVHQSLAMCRYVAKQINLAG DNPLEALQIDAIVDTI in isoform B.
VSP_029900

Experimental info

Sequence conflict491G → R in AAA29358. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform A [UniParc].

Last modified December 4, 2007. Version 4.
Checksum: 99EF5E78AA1A7595

FASTA20323,246
        10         20         30         40         50         60 
MPDYKVYYFN VKALGEPLRF LLSYGNLPFD DVRITREEWP ALKPTMPMGQ MPVLEVDGKK 

        70         80         90        100        110        120 
VHQSVAMSRY LANQVGLAGA DDWENLMIDT VVDTVNDFRL KIAIVAYEPD DMVKEKKMVT 

       130        140        150        160        170        180 
LNNEVIPFYL TKLNVIAKEN NGHLVLGKPT WADVYFAGIL DYLNYLTKTN LLENFPNLQE 

       190        200 
VVQKVLDNEN VKAYIAKRPI TEV 

« Hide

Isoform B [UniParc].

Checksum: 403F5B0F0057BC28
Show »

FASTA20323,279

References

« Hide 'large scale' references
[1]"A glutathione S-transferase gene of the vector mosquito, Anopheles gambiae."
Reiss R.A., James A.A.
Insect Mol. Biol. 2:25-32(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
Strain: G3.
[2]"The genome sequence of the malaria mosquito Anopheles gambiae."
Holt R.A., Subramanian G.M., Halpern A., Sutton G.G., Charlab R., Nusskern D.R., Wincker P., Clark A.G., Ribeiro J.M.C., Wides R., Salzberg S.L., Loftus B.J., Yandell M.D., Majoros W.H., Rusch D.B., Lai Z., Kraft C.L., Abril J.F. expand/collapse author list , Anthouard V., Arensburger P., Atkinson P.W., Baden H., de Berardinis V., Baldwin D., Benes V., Biedler J., Blass C., Bolanos R., Boscus D., Barnstead M., Cai S., Center A., Chaturverdi K., Christophides G.K., Chrystal M.A.M., Clamp M., Cravchik A., Curwen V., Dana A., Delcher A., Dew I., Evans C.A., Flanigan M., Grundschober-Freimoser A., Friedli L., Gu Z., Guan P., Guigo R., Hillenmeyer M.E., Hladun S.L., Hogan J.R., Hong Y.S., Hoover J., Jaillon O., Ke Z., Kodira C.D., Kokoza E., Koutsos A., Letunic I., Levitsky A.A., Liang Y., Lin J.-J., Lobo N.F., Lopez J.R., Malek J.A., McIntosh T.C., Meister S., Miller J.R., Mobarry C., Mongin E., Murphy S.D., O'Brochta D.A., Pfannkoch C., Qi R., Regier M.A., Remington K., Shao H., Sharakhova M.V., Sitter C.D., Shetty J., Smith T.J., Strong R., Sun J., Thomasova D., Ton L.Q., Topalis P., Tu Z.J., Unger M.F., Walenz B., Wang A.H., Wang J., Wang M., Wang X., Woodford K.J., Wortman J.R., Wu M., Yao A., Zdobnov E.M., Zhang H., Zhao Q., Zhao S., Zhu S.C., Zhimulev I., Coluzzi M., della Torre A., Roth C.W., Louis C., Kalush F., Mural R.J., Myers E.W., Adams M.D., Smith H.O., Broder S., Gardner M.J., Fraser C.M., Birney E., Bork P., Brey P.T., Venter J.C., Weissenbach J., Kafatos F.C., Collins F.H., Hoffman S.L.
Science 298:129-149(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: PEST.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L07880 mRNA. Translation: AAA29358.1. Different initiation.
AAAB01008849 Genomic DNA. Translation: EAA45010.4. Different initiation.

3D structure databases

ProteinModelPortalP46428.
SMRP46428. Positions 4-203.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING7165.AGAP010404-PA.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

KEGGaga:AgaP_AGAP010404.
VectorBaseAGAP010404. Anopheles gambiae.

Organism-specific databases

CTD1272645.

Phylogenomic databases

eggNOGNOG122057.
HOGENOMHOG000115733.
InParanoidP46428.
OrthoDBEOG78WKT1.

Family and domain databases

Gene3D1.20.1050.10. 1 hit.
3.40.30.10. 1 hit.
InterProIPR010987. Glutathione-S-Trfase_C-like.
IPR004045. Glutathione_S-Trfase_N.
IPR004046. GST_C.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PfamPF00043. GST_C. 1 hit.
PF02798. GST_N. 1 hit.
[Graphical view]
SUPFAMSSF47616. SSF47616. 1 hit.
SSF52833. SSF52833. 1 hit.
PROSITEPS50405. GST_CTER. 1 hit.
PS50404. GST_NTER. 1 hit.
[Graphical view]
ProtoNetSearch...

Entry information

Entry nameGST_ANOGA
AccessionPrimary (citable) accession number: P46428
Secondary accession number(s): Q7PGA2
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: December 4, 2007
Last modified: April 16, 2014
This is version 83 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)

Relevant documents

SIMILARITY comments

Index of protein domains and families