Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P46428

- GST_ANOGA

UniProt

P46428 - GST_ANOGA

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Glutathione S-transferase

Gene

GstS1

Organism
Anopheles gambiae (African malaria mosquito)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Catalytic activityi

RX + glutathione = HX + R-S-glutathione.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei8 – 81GlutathioneBy similarity
Binding sitei39 – 391GlutathioneBy similarity
Binding sitei43 – 431GlutathioneBy similarity

GO - Molecular functioni

  1. glutathione transferase activity Source: UniProtKB-EC
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Names & Taxonomyi

Protein namesi
Recommended name:
Glutathione S-transferase (EC:2.5.1.18)
Alternative name(s):
GST class-sigma
Gene namesi
Name:GstS1
ORF Names:AGAP010404
OrganismiAnopheles gambiae (African malaria mosquito)
Taxonomic identifieri7165 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraNematoceraCulicoideaCulicidaeAnophelinaeAnopheles
ProteomesiUP000007062: Chromosome 3L

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 203203Glutathione S-transferasePRO_0000185915Add
BLAST

Interactioni

Subunit structurei

Homodimer.By similarity

Protein-protein interaction databases

STRINGi7165.AGAP010404-PA.

Structurei

3D structure databases

ProteinModelPortaliP46428.
SMRiP46428. Positions 4-203.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini2 – 7978GST N-terminalAdd
BLAST
Domaini81 – 203123GST C-terminalAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni50 – 512Glutathione bindingBy similarity
Regioni63 – 642Glutathione bindingBy similarity

Sequence similaritiesi

Belongs to the GST superfamily. Sigma family.Curated
Contains 1 GST C-terminal domain.Curated
Contains 1 GST N-terminal domain.Curated

Phylogenomic databases

eggNOGiNOG122057.
HOGENOMiHOG000115733.
InParanoidiP46428.
OrthoDBiEOG78WKT1.

Family and domain databases

Gene3Di1.20.1050.10. 1 hit.
3.40.30.10. 1 hit.
InterProiIPR010987. Glutathione-S-Trfase_C-like.
IPR004045. Glutathione_S-Trfase_N.
IPR004046. GST_C.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PfamiPF00043. GST_C. 1 hit.
PF02798. GST_N. 1 hit.
[Graphical view]
SUPFAMiSSF47616. SSF47616. 1 hit.
SSF52833. SSF52833. 1 hit.
PROSITEiPS50405. GST_CTER. 1 hit.
PS50404. GST_NTER. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform A (identifier: P46428-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPDYKVYYFN VKALGEPLRF LLSYGNLPFD DVRITREEWP ALKPTMPMGQ
60 70 80 90 100
MPVLEVDGKK VHQSVAMSRY LANQVGLAGA DDWENLMIDT VVDTVNDFRL
110 120 130 140 150
KIAIVAYEPD DMVKEKKMVT LNNEVIPFYL TKLNVIAKEN NGHLVLGKPT
160 170 180 190 200
WADVYFAGIL DYLNYLTKTN LLENFPNLQE VVQKVLDNEN VKAYIAKRPI

TEV

Note: No experimental confirmation available.

Length:203
Mass (Da):23,246
Last modified:December 4, 2007 - v4
Checksum:i99EF5E78AA1A7595
GO
Isoform B (identifier: P46428-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     60-95: KVHQSVAMSRYLANQVGLAGADDWENLMIDTVVDTV → RVHQSLAMCRYVAKQINLAGDNPLEALQIDAIVDTI

Show »
Length:203
Mass (Da):23,279
Checksum:i403F5B0F0057BC28
GO

Sequence cautioni

The sequence AAA29358.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence EAA45010.4 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti49 – 491G → R in AAA29358. (PubMed:9087540)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei60 – 9536KVHQS…VVDTV → RVHQSLAMCRYVAKQINLAG DNPLEALQIDAIVDTI in isoform B. 1 PublicationVSP_029900Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L07880 mRNA. Translation: AAA29358.1. Different initiation.
AAAB01008849 Genomic DNA. Translation: EAA45010.4. Different initiation.
RefSeqiXP_311546.4. XM_311546.4.

Genome annotation databases

GeneIDi1272645.
KEGGiaga:AgaP_AGAP010404.
VectorBaseiAGAP010404. Anopheles gambiae.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L07880 mRNA. Translation: AAA29358.1 . Different initiation.
AAAB01008849 Genomic DNA. Translation: EAA45010.4 . Different initiation.
RefSeqi XP_311546.4. XM_311546.4.

3D structure databases

ProteinModelPortali P46428.
SMRi P46428. Positions 4-203.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 7165.AGAP010404-PA.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 1272645.
KEGGi aga:AgaP_AGAP010404.
VectorBasei AGAP010404. Anopheles gambiae.

Organism-specific databases

CTDi 1272645.

Phylogenomic databases

eggNOGi NOG122057.
HOGENOMi HOG000115733.
InParanoidi P46428.
OrthoDBi EOG78WKT1.

Family and domain databases

Gene3Di 1.20.1050.10. 1 hit.
3.40.30.10. 1 hit.
InterProi IPR010987. Glutathione-S-Trfase_C-like.
IPR004045. Glutathione_S-Trfase_N.
IPR004046. GST_C.
IPR012336. Thioredoxin-like_fold.
[Graphical view ]
Pfami PF00043. GST_C. 1 hit.
PF02798. GST_N. 1 hit.
[Graphical view ]
SUPFAMi SSF47616. SSF47616. 1 hit.
SSF52833. SSF52833. 1 hit.
PROSITEi PS50405. GST_CTER. 1 hit.
PS50404. GST_NTER. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A glutathione S-transferase gene of the vector mosquito, Anopheles gambiae."
    Reiss R.A., James A.A.
    Insect Mol. Biol. 2:25-32(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
    Strain: G3.
  2. "The genome sequence of the malaria mosquito Anopheles gambiae."
    Holt R.A., Subramanian G.M., Halpern A., Sutton G.G., Charlab R., Nusskern D.R., Wincker P., Clark A.G., Ribeiro J.M.C., Wides R., Salzberg S.L., Loftus B.J., Yandell M.D., Majoros W.H., Rusch D.B., Lai Z., Kraft C.L., Abril J.F.
    , Anthouard V., Arensburger P., Atkinson P.W., Baden H., de Berardinis V., Baldwin D., Benes V., Biedler J., Blass C., Bolanos R., Boscus D., Barnstead M., Cai S., Center A., Chaturverdi K., Christophides G.K., Chrystal M.A.M., Clamp M., Cravchik A., Curwen V., Dana A., Delcher A., Dew I., Evans C.A., Flanigan M., Grundschober-Freimoser A., Friedli L., Gu Z., Guan P., Guigo R., Hillenmeyer M.E., Hladun S.L., Hogan J.R., Hong Y.S., Hoover J., Jaillon O., Ke Z., Kodira C.D., Kokoza E., Koutsos A., Letunic I., Levitsky A.A., Liang Y., Lin J.-J., Lobo N.F., Lopez J.R., Malek J.A., McIntosh T.C., Meister S., Miller J.R., Mobarry C., Mongin E., Murphy S.D., O'Brochta D.A., Pfannkoch C., Qi R., Regier M.A., Remington K., Shao H., Sharakhova M.V., Sitter C.D., Shetty J., Smith T.J., Strong R., Sun J., Thomasova D., Ton L.Q., Topalis P., Tu Z.J., Unger M.F., Walenz B., Wang A.H., Wang J., Wang M., Wang X., Woodford K.J., Wortman J.R., Wu M., Yao A., Zdobnov E.M., Zhang H., Zhao Q., Zhao S., Zhu S.C., Zhimulev I., Coluzzi M., della Torre A., Roth C.W., Louis C., Kalush F., Mural R.J., Myers E.W., Adams M.D., Smith H.O., Broder S., Gardner M.J., Fraser C.M., Birney E., Bork P., Brey P.T., Venter J.C., Weissenbach J., Kafatos F.C., Collins F.H., Hoffman S.L.
    Science 298:129-149(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: PEST.

Entry informationi

Entry nameiGST_ANOGA
AccessioniPrimary (citable) accession number: P46428
Secondary accession number(s): Q7PGA2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: December 4, 2007
Last modified: October 1, 2014
This is version 87 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3