Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P46428

- GST_ANOGA

UniProt

P46428 - GST_ANOGA

Protein

Glutathione S-transferase

Gene

GstS1

Organism
Anopheles gambiae (African malaria mosquito)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 4 (04 Dec 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

    Catalytic activityi

    RX + glutathione = HX + R-S-glutathione.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei8 – 81GlutathioneBy similarity
    Binding sitei39 – 391GlutathioneBy similarity
    Binding sitei43 – 431GlutathioneBy similarity

    GO - Molecular functioni

    1. glutathione transferase activity Source: UniProtKB-EC

    Keywords - Molecular functioni

    Transferase

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Glutathione S-transferase (EC:2.5.1.18)
    Alternative name(s):
    GST class-sigma
    Gene namesi
    Name:GstS1
    ORF Names:AGAP010404
    OrganismiAnopheles gambiae (African malaria mosquito)
    Taxonomic identifieri7165 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraNematoceraCulicoideaCulicidaeAnophelinaeAnopheles
    ProteomesiUP000007062: Chromosome 3L

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 203203Glutathione S-transferasePRO_0000185915Add
    BLAST

    Interactioni

    Subunit structurei

    Homodimer.By similarity

    Protein-protein interaction databases

    STRINGi7165.AGAP010404-PA.

    Structurei

    3D structure databases

    ProteinModelPortaliP46428.
    SMRiP46428. Positions 4-203.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini2 – 7978GST N-terminalAdd
    BLAST
    Domaini81 – 203123GST C-terminalAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni50 – 512Glutathione bindingBy similarity
    Regioni63 – 642Glutathione bindingBy similarity

    Sequence similaritiesi

    Belongs to the GST superfamily. Sigma family.Curated
    Contains 1 GST C-terminal domain.Curated
    Contains 1 GST N-terminal domain.Curated

    Phylogenomic databases

    eggNOGiNOG122057.
    HOGENOMiHOG000115733.
    InParanoidiP46428.
    OrthoDBiEOG78WKT1.

    Family and domain databases

    Gene3Di1.20.1050.10. 1 hit.
    3.40.30.10. 1 hit.
    InterProiIPR010987. Glutathione-S-Trfase_C-like.
    IPR004045. Glutathione_S-Trfase_N.
    IPR004046. GST_C.
    IPR012336. Thioredoxin-like_fold.
    [Graphical view]
    PfamiPF00043. GST_C. 1 hit.
    PF02798. GST_N. 1 hit.
    [Graphical view]
    SUPFAMiSSF47616. SSF47616. 1 hit.
    SSF52833. SSF52833. 1 hit.
    PROSITEiPS50405. GST_CTER. 1 hit.
    PS50404. GST_NTER. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform A (identifier: P46428-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPDYKVYYFN VKALGEPLRF LLSYGNLPFD DVRITREEWP ALKPTMPMGQ    50
    MPVLEVDGKK VHQSVAMSRY LANQVGLAGA DDWENLMIDT VVDTVNDFRL 100
    KIAIVAYEPD DMVKEKKMVT LNNEVIPFYL TKLNVIAKEN NGHLVLGKPT 150
    WADVYFAGIL DYLNYLTKTN LLENFPNLQE VVQKVLDNEN VKAYIAKRPI 200
    TEV 203

    Note: No experimental confirmation available.

    Length:203
    Mass (Da):23,246
    Last modified:December 4, 2007 - v4
    Checksum:i99EF5E78AA1A7595
    GO
    Isoform B (identifier: P46428-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         60-95: KVHQSVAMSRYLANQVGLAGADDWENLMIDTVVDTV → RVHQSLAMCRYVAKQINLAGDNPLEALQIDAIVDTI

    Show »
    Length:203
    Mass (Da):23,279
    Checksum:i403F5B0F0057BC28
    GO

    Sequence cautioni

    The sequence AAA29358.1 differs from that shown. Reason: Erroneous initiation.
    The sequence EAA45010.4 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti49 – 491G → R in AAA29358. (PubMed:9087540)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei60 – 9536KVHQS…VVDTV → RVHQSLAMCRYVAKQINLAG DNPLEALQIDAIVDTI in isoform B. 1 PublicationVSP_029900Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L07880 mRNA. Translation: AAA29358.1. Different initiation.
    AAAB01008849 Genomic DNA. Translation: EAA45010.4. Different initiation.
    RefSeqiXP_311546.4. XM_311546.4.

    Genome annotation databases

    GeneIDi1272645.
    KEGGiaga:AgaP_AGAP010404.
    VectorBaseiAGAP010404. Anopheles gambiae.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L07880 mRNA. Translation: AAA29358.1 . Different initiation.
    AAAB01008849 Genomic DNA. Translation: EAA45010.4 . Different initiation.
    RefSeqi XP_311546.4. XM_311546.4.

    3D structure databases

    ProteinModelPortali P46428.
    SMRi P46428. Positions 4-203.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 7165.AGAP010404-PA.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 1272645.
    KEGGi aga:AgaP_AGAP010404.
    VectorBasei AGAP010404. Anopheles gambiae.

    Organism-specific databases

    CTDi 1272645.

    Phylogenomic databases

    eggNOGi NOG122057.
    HOGENOMi HOG000115733.
    InParanoidi P46428.
    OrthoDBi EOG78WKT1.

    Family and domain databases

    Gene3Di 1.20.1050.10. 1 hit.
    3.40.30.10. 1 hit.
    InterProi IPR010987. Glutathione-S-Trfase_C-like.
    IPR004045. Glutathione_S-Trfase_N.
    IPR004046. GST_C.
    IPR012336. Thioredoxin-like_fold.
    [Graphical view ]
    Pfami PF00043. GST_C. 1 hit.
    PF02798. GST_N. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47616. SSF47616. 1 hit.
    SSF52833. SSF52833. 1 hit.
    PROSITEi PS50405. GST_CTER. 1 hit.
    PS50404. GST_NTER. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A glutathione S-transferase gene of the vector mosquito, Anopheles gambiae."
      Reiss R.A., James A.A.
      Insect Mol. Biol. 2:25-32(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
      Strain: G3.
    2. "The genome sequence of the malaria mosquito Anopheles gambiae."
      Holt R.A., Subramanian G.M., Halpern A., Sutton G.G., Charlab R., Nusskern D.R., Wincker P., Clark A.G., Ribeiro J.M.C., Wides R., Salzberg S.L., Loftus B.J., Yandell M.D., Majoros W.H., Rusch D.B., Lai Z., Kraft C.L., Abril J.F.
      , Anthouard V., Arensburger P., Atkinson P.W., Baden H., de Berardinis V., Baldwin D., Benes V., Biedler J., Blass C., Bolanos R., Boscus D., Barnstead M., Cai S., Center A., Chaturverdi K., Christophides G.K., Chrystal M.A.M., Clamp M., Cravchik A., Curwen V., Dana A., Delcher A., Dew I., Evans C.A., Flanigan M., Grundschober-Freimoser A., Friedli L., Gu Z., Guan P., Guigo R., Hillenmeyer M.E., Hladun S.L., Hogan J.R., Hong Y.S., Hoover J., Jaillon O., Ke Z., Kodira C.D., Kokoza E., Koutsos A., Letunic I., Levitsky A.A., Liang Y., Lin J.-J., Lobo N.F., Lopez J.R., Malek J.A., McIntosh T.C., Meister S., Miller J.R., Mobarry C., Mongin E., Murphy S.D., O'Brochta D.A., Pfannkoch C., Qi R., Regier M.A., Remington K., Shao H., Sharakhova M.V., Sitter C.D., Shetty J., Smith T.J., Strong R., Sun J., Thomasova D., Ton L.Q., Topalis P., Tu Z.J., Unger M.F., Walenz B., Wang A.H., Wang J., Wang M., Wang X., Woodford K.J., Wortman J.R., Wu M., Yao A., Zdobnov E.M., Zhang H., Zhao Q., Zhao S., Zhu S.C., Zhimulev I., Coluzzi M., della Torre A., Roth C.W., Louis C., Kalush F., Mural R.J., Myers E.W., Adams M.D., Smith H.O., Broder S., Gardner M.J., Fraser C.M., Birney E., Bork P., Brey P.T., Venter J.C., Weissenbach J., Kafatos F.C., Collins F.H., Hoffman S.L.
      Science 298:129-149(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: PEST.

    Entry informationi

    Entry nameiGST_ANOGA
    AccessioniPrimary (citable) accession number: P46428
    Secondary accession number(s): Q7PGA2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1995
    Last sequence update: December 4, 2007
    Last modified: October 1, 2014
    This is version 87 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3