Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Large proline-rich protein BAG6

Gene

BAG6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

ATP-independent molecular chaperone preventing the aggregation of misfolded and hydrophobic patches-containing proteins (PubMed:21636303). Functions as part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, which maintains these client proteins in a soluble state and participates to their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation (PubMed:20516149, PubMed:21636303, PubMed:21743475, PubMed:28104892). The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum (PubMed:20516149, PubMed:20676083, PubMed:28104892). Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated by RNF126, an E3 ubiquitin-protein ligase associated with BAG6 and are sorted to the proteasome (PubMed:24981174, PubMed:28104892, PubMed:27193484). SGTA which prevents the recruitment of RNF126 to BAG6 may negatively regulate the ubiquitination and the proteasomal degradation of client proteins (PubMed:23129660, PubMed:25179605, PubMed:27193484). Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum (PubMed:21743475). The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD), a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome (PubMed:21636303). BAG6 is also required for selective ubiquitin-mediated degradation of defective nascent chain polypeptides by the proteasome. In this context, it may participate to the production of antigenic peptides and play a role in antigen presentation in immune response (By similarity). BAG6 is also involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation. BAG6 may ensure the proper degradation of these proteins and thereby protects the endoplasmic reticulum from protein overload upon stress (PubMed:26565908). By inhibiting the polyubiquitination and subsequent proteasomal degradation of HSPA2 it may also play a role in the assembly of the synaptonemal complex during spermatogenesis (By similarity). Also positively regulates apoptosis by interacting with and stabilizing the proapoptotic factor AIFM1 (By similarity).By similarity10 Publications
Involved in DNA damage-induced apoptosis: following DNA damage, accumulates in the nucleus and forms a complex with p300/EP300, enhancing p300/EP300-mediated p53/TP53 acetylation leading to increase p53/TP53 transcriptional activity (PubMed:17403783). When nuclear, may also act as a component of some chromatin regulator complex that regulates histone 3 'Lys-4' dimethylation (H3K4me2) (PubMed:18765639).2 Publications
Released extracellularly via exosomes, it is a ligand of the natural killer/NK cells receptor NCR3 and stimulates NK cells cytotoxicity. It may thereby trigger NK cells cytotoxicity against neighboring tumor cells and immature myeloid dendritic cells (DC).2 Publications
Mediates ricin-induced apoptosis.1 Publication

GO - Molecular functioni

  • misfolded protein binding Source: ParkinsonsUK-UCL
  • polyubiquitin binding Source: UniProtKB
  • proteasome binding Source: UniProtKB
  • receptor binding Source: UniProtKB
  • ribosome binding Source: UniProtKB
  • toxic substance binding Source: UniProtKB
  • ubiquitin protein ligase binding Source: UniProtKB
  • ubiquitin-specific protease binding Source: ParkinsonsUK-UCL

GO - Biological processi

Keywordsi

Molecular functionChaperone, Chromatin regulator
Biological processApoptosis, Differentiation, Immunity, Spermatogenesis, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Large proline-rich protein BAG6Curated
Alternative name(s):
BAG family molecular chaperone regulator 6
BCL2-associated athanogene 6Imported
Short name:
BAG-6
HLA-B-associated transcript 31 Publication
Protein G3
Protein Scythe1 Publication
Gene namesi
Name:BAG6Imported
Synonyms:BAT31 Publication, G3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:13919. BAG6.

Subcellular locationi

GO - Cellular componenti

  • BAT3 complex Source: UniProtKB
  • cytoplasm Source: ParkinsonsUK-UCL
  • cytosol Source: UniProtKB
  • extracellular exosome Source: UniProtKB
  • intracellular membrane-bounded organelle Source: HPA
  • membrane Source: UniProtKB
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB

Keywords - Cellular componenti

Cytoplasm, Nucleus, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1001D → A: Abolishes cleavage by the caspase CASP3. 1 Publication1

Organism-specific databases

DisGeNETi7917.
OpenTargetsiENSG00000204463.
PharmGKBiPA25264.

Polymorphism and mutation databases

BioMutaiBAG6.
DMDMi76800648.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001148971 – 1132Large proline-rich protein BAG6Add BLAST1132

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei96PhosphoserineCombined sources1
Modified residuei113PhosphoserineCombined sources1
Modified residuei117PhosphothreonineCombined sources1
Modified residuei350PhosphothreonineCombined sources1
Modified residuei964PhosphoserineCombined sources1
Modified residuei973PhosphoserineCombined sources1
Modified residuei1053PhosphothreonineCombined sources1
Modified residuei1081PhosphoserineCombined sources1
Modified residuei1117PhosphoserineCombined sources1
Isoform 4 (identifier: P46379-4)
Modified residuei832PhosphoserineCombined sources1

Post-translational modificationi

Ricin can induce a cleavage by the caspase CASP3. The released C-terminal peptide induces apoptosis.1 Publication
(Microbial infection) In case of infection by L.pneumophila, ubiquitinated by the SCF(LegU1) complex.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei1001 – 1002Cleavage; by CASP31 Publication2

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP46379.
MaxQBiP46379.
PaxDbiP46379.
PeptideAtlasiP46379.
PRIDEiP46379.

PTM databases

iPTMnetiP46379.
PhosphoSitePlusiP46379.
SwissPalmiP46379.

Miscellaneous databases

PMAP-CutDBiB0UX84.

Expressioni

Tissue specificityi

Expressed by immature dendritic cells (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000096155.
ExpressionAtlasiP46379. baseline and differential.
GenevisibleiP46379. HS.

Organism-specific databases

HPAiCAB020704.
HPA045116.
HPA053291.

Interactioni

Subunit structurei

Component of the BAG6/BAT3 complex, also named BAT3 complex, at least composed of BAG6, UBL4A and GET4/TRC35 (PubMed:20676083). Interacts with GET4; the interaction is direct and localizes BAG6 in the cytosol (PubMed:21636303). Interacts with AIFM1 (By similarity). Interacts with HSPA2 (By similarity). Interacts with CTCFL (PubMed:18765639). Interacts with p300/EP300 (PubMed:17403783). Interacts (via ubiquitin-like domain) with RNF126; required for BAG6-dependent ubiquitination of proteins mislocalized to the cytosol (PubMed:24981174, PubMed:27193484). Interacts (via ubiquitin-like domain) with SGTA; SGTA competes with RNF126 by binding the same region of BAG6, thereby promoting deubiquitination of BAG6-target proteins and rescuing them from degradation (PubMed:23129660, PubMed:24424410, PubMed:25179605, PubMed:27193484). Interacts with ricin A chain (PubMed:14960581). Interacts with VCP and AMFR; both form the VCP/p97-AMFR/gp78 complex (PubMed:21636303). Interacts with SYVN1 (PubMed:21636303). Interacts with USP13; the interaction is direct and may mediate UBL4A deubiquitination (PubMed:24424410).By similarity10 Publications
(Microbial infection) Interacts with L. pneumophila Lpg2160 and LegU1 proteins.1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

  • misfolded protein binding Source: ParkinsonsUK-UCL
  • polyubiquitin binding Source: UniProtKB
  • proteasome binding Source: UniProtKB
  • receptor binding Source: UniProtKB
  • ubiquitin protein ligase binding Source: UniProtKB
  • ubiquitin-specific protease binding Source: ParkinsonsUK-UCL

Protein-protein interaction databases

BioGridi113647. 284 interactors.
DIPiDIP-31191N.
IntActiP46379. 256 interactors.
MINTiMINT-1032268.
STRINGi9606.ENSP00000365131.

Structurei

Secondary structure

11132
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi16 – 23Combined sources8
Beta strandi28 – 34Combined sources7
Beta strandi35 – 37Combined sources3
Helixi39 – 50Combined sources12
Helixi54 – 56Combined sources3
Beta strandi57 – 61Combined sources5
Beta strandi64 – 66Combined sources3
Beta strandi68 – 71Combined sources4
Helixi72 – 75Combined sources4
Beta strandi80 – 86Combined sources7
Turni91 – 93Combined sources3
Helixi1063 – 1074Combined sources12
Helixi1082 – 1089Combined sources8
Helixi1092 – 1110Combined sources19

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WX9NMR-A17-89[»]
2N9PNMR-C17-101[»]
4DWFX-ray1.80A/B13-101[»]
4EEWX-ray1.30A/B1-87[»]
4WWRX-ray2.00A/C/E/G1060-1111[»]
4X86X-ray1.85B1048-1123[»]
ProteinModelPortaliP46379.
SMRiP46379.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP46379.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini17 – 92Ubiquitin-likePROSITE-ProRule annotationAdd BLAST76
Repeati242 – 27011 PublicationAdd BLAST29
Repeati415 – 44321 PublicationAdd BLAST29
Repeati574 – 60231 PublicationAdd BLAST29
Repeati608 – 63641 PublicationAdd BLAST29

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni242 – 6364 X 29 AA approximate repeats1 PublicationAdd BLAST395
Regioni1022 – 1132Mediates interaction with UBL4A and GET4 and is sufficient for the delivery of client proteins to the endoplasmic reticulum1 PublicationAdd BLAST111

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi195 – 273Pro-richPROSITE-ProRule annotationAdd BLAST79
Compositional biasi394 – 681Pro-richPROSITE-ProRule annotationAdd BLAST288

Domaini

The ubiquitin-like domain mediates interaction with the E3 ubiquitin-protein ligase RNF126 which is responsible for the BAG6-dependent ubiquitination of client proteins (PubMed:21743475, PubMed:24981174, PubMed:28104892, PubMed:27193484). SGTA also binds this domain and competes with RNF126 to antagonize client protein ubiquitination and degradation (PubMed:28104892). The ubiquitin-like domain also mediates the interaction with USP13 (PubMed:24424410).5 Publications

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG4248. Eukaryota.
ENOG410XS9P. LUCA.
GeneTreeiENSGT00390000016199.
HOVERGENiHBG002193.
InParanoidiP46379.
OMAiPFIERTH.
OrthoDBiEOG091G0XSR.
PhylomeDBiP46379.
TreeFamiTF328437.

Family and domain databases

InterProiView protein in InterPro
IPR021925. DUF3538.
IPR029071. Ubiquitin-rel_dom.
IPR019954. Ubiquitin_CS.
IPR000626. Ubiquitin_dom.
PfamiView protein in Pfam
PF12057. DUF3538. 1 hit.
PF00240. ubiquitin. 1 hit.
SMARTiView protein in SMART
SM00213. UBQ. 1 hit.
SUPFAMiSSF54236. SSF54236. 1 hit.
PROSITEiView protein in PROSITE
PS00299. UBIQUITIN_1. 1 hit.
PS50053. UBIQUITIN_2. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P46379-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPNDSTSTA VEEPDSLEVL VKTLDSQTRT FIVGAQMNVK EFKEHIAASV
60 70 80 90 100
SIPSEKQRLI YQGRVLQDDK KLQEYNVGGK VIHLVERAPP QTHLPSGASS
110 120 130 140 150
GTGSASATHG GGSPPGTRGP GASVHDRNAN SYVMVGTFNL PSDGSAVDVH
160 170 180 190 200
INMEQAPIQS EPRVRLVMAQ HMIRDIQTLL SRMETLPYLQ CRGGPQPQHS
210 220 230 240 250
QPPPQPPAVT PEPVALSSQT SEPVESEAPP REPMEAEEVE ERAPAQNPEL
260 270 280 290 300
TPGPAPAGPT PAPETNAPNH PSPAEYVEVL QELQRLESRL QPFLQRYYEV
310 320 330 340 350
LGAAATTDYN NNHEGREEDQ RLINLVGESL RLLGNTFVAL SDLRCNLACT
360 370 380 390 400
PPRHLHVVRP MSHYTTPMVL QQAAIPIQIN VGTTVTMTGN GTRPPPTPNA
410 420 430 440 450
EAPPPGPGQA SSVAPSSTNV ESSAEGAPPP GPAPPPATSH PRVIRISHQS
460 470 480 490 500
VEPVVMMHMN IQDSGTQPGG VPSAPTGPLG PPGHGQTLGQ QVPGFPTAPT
510 520 530 540 550
RVVIARPTPP QARPSHPGGP PVSGTLQGAG LGTNASLAQM VSGLVGQLLM
560 570 580 590 600
QPVLVAQGTP GMAPPPAPAT ASASAGTTNT ATTAGPAPGG PAQPPPTPQP
610 620 630 640 650
SMADLQFSQL LGNLLGPAGP GAGGSGVASP TITVAMPGVP AFLQGMTDFL
660 670 680 690 700
QATQTAPPPP PPPPPPPPAP EQQTMPPPGS PSGGAGSPGG LGLESLSPEF
710 720 730 740 750
FTSVVQGVLS SLLGSLGARA GSSESIAAFI QRLSGSSNIF EPGADGALGF
760 770 780 790 800
FGALLSLLCQ NFSMVDVVML LHGHFQPLQR LQPQLRSFFH QHYLGGQEPT
810 820 830 840 850
PSNIRMATHT LITGLEEYVR ESFSLVQVQP GVDIIRTNLE FLQEQFNSIA
860 870 880 890 900
AHVLHCTDSG FGARLLELCN QGLFECLALN LHCLGGQQME LAAVINGRIR
910 920 930 940 950
RMSRGVNPSL VSWLTTMMGL RLQVVLEHMP VGPDAILRYV RRVGDPPQPL
960 970 980 990 1000
PEEPMEVQGA ERASPEPQRE NASPAPGTTA EEAMSRGPPP APEGGSRDEQ
1010 1020 1030 1040 1050
DGASAETEPW AAAVPPEWVP IIQQDIQSQR KVKPQPPLSD AYLSGMPAKR
1060 1070 1080 1090 1100
RKTMQGEGPQ LLLSEAVSRA AKAAGARPLT SPESLSRDLE APEVQESYRQ
1110 1120 1130
QLRSDIQKRL QEDPNYSPQR FPNAQRAFAD DP
Length:1,132
Mass (Da):119,409
Last modified:September 27, 2005 - v2
Checksum:i625B5F86321367ED
GO
Isoform 2 (identifier: P46379-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-190: Missing.

Show »
Length:1,126
Mass (Da):118,693
Checksum:i8A67290BC8176ABA
GO
Isoform 3 (identifier: P46379-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-190: Missing.
     489-489: G → GSTLIQLPSLPPEFMHAVAHQITHQAMVAAVASAAAG

Note: No experimental confirmation available.
Show »
Length:1,162
Mass (Da):122,342
Checksum:iFE67886ACE6F6432
GO
Isoform 4 (identifier: P46379-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-190: Missing.
     527-527: Missing.
     561-685: Missing.
     969-1016: Missing.
     1053-1101: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:903
Mass (Da):96,800
Checksum:i71B4D33EB924A0EA
GO
Isoform 5 (identifier: P46379-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-190: Missing.
     1053-1101: Missing.

Note: No experimental confirmation available.
Show »
Length:1,077
Mass (Da):113,456
Checksum:iCB94D1C58A1E3D21
GO

Sequence cautioni

The sequence AAD18085 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB63390 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAI18318 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti43K → R in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti47A → R in AAA35587 (PubMed:2156268).Curated1
Sequence conflicti150H → D in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti511Q → R in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti561G → D in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti617P → L in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti679G → R in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti839L → R in BAG63924 (PubMed:14702039).Curated1
Sequence conflicti842L → P in BAG63924 (PubMed:14702039).Curated1
Sequence conflicti853V → M in CAI46045 (PubMed:17974005).Curated1
Sequence conflicti854L → Q in BAG65616 (PubMed:14702039).Curated1
Sequence conflicti927E → D in BAG65616 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_023531625S → P5 PublicationsCorresponds to variant dbSNP:rs1052486Ensembl.1
Natural variantiVAR_037150728A → V. Corresponds to variant dbSNP:rs11548856Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_015695185 – 190Missing in isoform 2, isoform 3, isoform 4 and isoform 5. 3 Publications6
Alternative sequenceiVSP_030519489G → GSTLIQLPSLPPEFMHAVAH QITHQAMVAAVASAAAG in isoform 3. Curated1
Alternative sequenceiVSP_045910527Missing in isoform 4. 1 Publication1
Alternative sequenceiVSP_045911561 – 685Missing in isoform 4. 1 PublicationAdd BLAST125
Alternative sequenceiVSP_045912969 – 1016Missing in isoform 4. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_0459131053 – 1101Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M33519 mRNA. Translation: AAA35587.1.
M33521, M33520 Genomic DNA. Translation: AAA35588.1.
BX647244 mRNA. Translation: CAI46045.1.
AK302695 mRNA. Translation: BAG63924.1.
AK304879 mRNA. Translation: BAG65616.1.
AF129756 Genomic DNA. Translation: AAD18085.1. Different initiation.
BA000025 Genomic DNA. Translation: BAB63390.1. Different initiation.
AL662801 Genomic DNA. Translation: CAI18314.1.
AL662801 Genomic DNA. Translation: CAI18315.1.
AL662801 Genomic DNA. Translation: CAI18316.2.
AL662801 Genomic DNA. Translation: CAI18318.2. Sequence problems.
AL662847, AL670886 Genomic DNA. Translation: CAI17658.1.
AL662847, AL670886 Genomic DNA. Translation: CAI17659.1.
AL670886, AL662847 Genomic DNA. Translation: CAI17784.1.
AL670886, AL662847 Genomic DNA. Translation: CAI17785.1.
AL670886, AL662847 Genomic DNA. Translation: CAI17786.1.
AL805934 Genomic DNA. Translation: CAI18501.1.
AL805934 Genomic DNA. Translation: CAI18504.1.
AL805934 Genomic DNA. Translation: CAI18508.2.
AL805934 Genomic DNA. Translation: CAI18509.1.
AL670886, AL662847 Genomic DNA. Translation: CAM25014.1.
BX511262 Genomic DNA. Translation: CAM45799.1.
BX511262 Genomic DNA. Translation: CAM45800.1.
BX511262 Genomic DNA. Translation: CAM45801.1.
AL662847, AL670886 Genomic DNA. Translation: CAO72072.1.
CR753842, CR753892 Genomic DNA. Translation: CAQ06558.1.
CR753892, CR753842 Genomic DNA. Translation: CAQ06931.1.
CR354443 Genomic DNA. Translation: CAQ06977.1.
CR759761 Genomic DNA. Translation: CAQ10854.1.
CH471081 Genomic DNA. Translation: EAX03455.1.
BC003133 mRNA. Translation: AAH03133.1.
CCDSiCCDS4709.1. [P46379-2]
CCDS47403.1. [P46379-1]
CCDS56414.1. [P46379-4]
CCDS56415.1. [P46379-5]
PIRiA35098.
RefSeqiNP_001092004.1. NM_001098534.1. [P46379-2]
NP_001186626.1. NM_001199697.1. [P46379-4]
NP_001186627.1. NM_001199698.1. [P46379-5]
NP_004630.3. NM_004639.3. [P46379-1]
NP_542433.1. NM_080702.2. [P46379-2]
NP_542434.1. NM_080703.2. [P46379-2]
XP_016866776.1. XM_017011287.1. [P46379-3]
UniGeneiHs.440900.

Genome annotation databases

EnsembliENST00000211379; ENSP00000211379; ENSG00000204463. [P46379-2]
ENST00000361076; ENSP00000354368; ENSG00000096155. [P46379-1]
ENST00000362049; ENSP00000354875; ENSG00000204463. [P46379-5]
ENST00000375964; ENSP00000365131; ENSG00000204463. [P46379-1]
ENST00000375976; ENSP00000365143; ENSG00000204463. [P46379-2]
ENST00000383446; ENSP00000372938; ENSG00000096155. [P46379-2]
ENST00000383448; ENSP00000372940; ENSG00000096155. [P46379-2]
ENST00000417144; ENSP00000412110; ENSG00000229524. [P46379-2]
ENST00000419847; ENSP00000389121; ENSG00000233348. [P46379-2]
ENST00000439687; ENSP00000402856; ENSG00000204463. [P46379-4]
ENST00000442479; ENSP00000413698; ENSG00000229524. [P46379-2]
ENST00000443182; ENSP00000410156; ENSG00000233348. [P46379-2]
ENST00000449450; ENSP00000397894; ENSG00000229524. [P46379-1]
ENST00000451932; ENSP00000390966; ENSG00000233348. [P46379-1]
ENST00000551350; ENSP00000447546; ENSG00000229524. [P46379-5]
ENST00000552116; ENSP00000447946; ENSG00000233348. [P46379-5]
ENST00000552605; ENSP00000446525; ENSG00000096155. [P46379-5]
ENST00000613474; ENSP00000478966; ENSG00000227761. [P46379-4]
ENST00000615143; ENSP00000482413; ENSG00000229524. [P46379-4]
ENST00000615224; ENSP00000477951; ENSG00000228760. [P46379-4]
ENST00000615725; ENSP00000479238; ENSG00000233348. [P46379-4]
ENST00000617635; ENSP00000484238; ENSG00000096155. [P46379-4]
ENST00000621056; ENSP00000477867; ENSG00000234651. [P46379-4]
GeneIDi7917.
KEGGihsa:7917.
UCSCiuc003nvf.4. human. [P46379-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M33519 mRNA. Translation: AAA35587.1.
M33521, M33520 Genomic DNA. Translation: AAA35588.1.
BX647244 mRNA. Translation: CAI46045.1.
AK302695 mRNA. Translation: BAG63924.1.
AK304879 mRNA. Translation: BAG65616.1.
AF129756 Genomic DNA. Translation: AAD18085.1. Different initiation.
BA000025 Genomic DNA. Translation: BAB63390.1. Different initiation.
AL662801 Genomic DNA. Translation: CAI18314.1.
AL662801 Genomic DNA. Translation: CAI18315.1.
AL662801 Genomic DNA. Translation: CAI18316.2.
AL662801 Genomic DNA. Translation: CAI18318.2. Sequence problems.
AL662847, AL670886 Genomic DNA. Translation: CAI17658.1.
AL662847, AL670886 Genomic DNA. Translation: CAI17659.1.
AL670886, AL662847 Genomic DNA. Translation: CAI17784.1.
AL670886, AL662847 Genomic DNA. Translation: CAI17785.1.
AL670886, AL662847 Genomic DNA. Translation: CAI17786.1.
AL805934 Genomic DNA. Translation: CAI18501.1.
AL805934 Genomic DNA. Translation: CAI18504.1.
AL805934 Genomic DNA. Translation: CAI18508.2.
AL805934 Genomic DNA. Translation: CAI18509.1.
AL670886, AL662847 Genomic DNA. Translation: CAM25014.1.
BX511262 Genomic DNA. Translation: CAM45799.1.
BX511262 Genomic DNA. Translation: CAM45800.1.
BX511262 Genomic DNA. Translation: CAM45801.1.
AL662847, AL670886 Genomic DNA. Translation: CAO72072.1.
CR753842, CR753892 Genomic DNA. Translation: CAQ06558.1.
CR753892, CR753842 Genomic DNA. Translation: CAQ06931.1.
CR354443 Genomic DNA. Translation: CAQ06977.1.
CR759761 Genomic DNA. Translation: CAQ10854.1.
CH471081 Genomic DNA. Translation: EAX03455.1.
BC003133 mRNA. Translation: AAH03133.1.
CCDSiCCDS4709.1. [P46379-2]
CCDS47403.1. [P46379-1]
CCDS56414.1. [P46379-4]
CCDS56415.1. [P46379-5]
PIRiA35098.
RefSeqiNP_001092004.1. NM_001098534.1. [P46379-2]
NP_001186626.1. NM_001199697.1. [P46379-4]
NP_001186627.1. NM_001199698.1. [P46379-5]
NP_004630.3. NM_004639.3. [P46379-1]
NP_542433.1. NM_080702.2. [P46379-2]
NP_542434.1. NM_080703.2. [P46379-2]
XP_016866776.1. XM_017011287.1. [P46379-3]
UniGeneiHs.440900.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WX9NMR-A17-89[»]
2N9PNMR-C17-101[»]
4DWFX-ray1.80A/B13-101[»]
4EEWX-ray1.30A/B1-87[»]
4WWRX-ray2.00A/C/E/G1060-1111[»]
4X86X-ray1.85B1048-1123[»]
ProteinModelPortaliP46379.
SMRiP46379.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113647. 284 interactors.
DIPiDIP-31191N.
IntActiP46379. 256 interactors.
MINTiMINT-1032268.
STRINGi9606.ENSP00000365131.

PTM databases

iPTMnetiP46379.
PhosphoSitePlusiP46379.
SwissPalmiP46379.

Polymorphism and mutation databases

BioMutaiBAG6.
DMDMi76800648.

Proteomic databases

EPDiP46379.
MaxQBiP46379.
PaxDbiP46379.
PeptideAtlasiP46379.
PRIDEiP46379.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000211379; ENSP00000211379; ENSG00000204463. [P46379-2]
ENST00000361076; ENSP00000354368; ENSG00000096155. [P46379-1]
ENST00000362049; ENSP00000354875; ENSG00000204463. [P46379-5]
ENST00000375964; ENSP00000365131; ENSG00000204463. [P46379-1]
ENST00000375976; ENSP00000365143; ENSG00000204463. [P46379-2]
ENST00000383446; ENSP00000372938; ENSG00000096155. [P46379-2]
ENST00000383448; ENSP00000372940; ENSG00000096155. [P46379-2]
ENST00000417144; ENSP00000412110; ENSG00000229524. [P46379-2]
ENST00000419847; ENSP00000389121; ENSG00000233348. [P46379-2]
ENST00000439687; ENSP00000402856; ENSG00000204463. [P46379-4]
ENST00000442479; ENSP00000413698; ENSG00000229524. [P46379-2]
ENST00000443182; ENSP00000410156; ENSG00000233348. [P46379-2]
ENST00000449450; ENSP00000397894; ENSG00000229524. [P46379-1]
ENST00000451932; ENSP00000390966; ENSG00000233348. [P46379-1]
ENST00000551350; ENSP00000447546; ENSG00000229524. [P46379-5]
ENST00000552116; ENSP00000447946; ENSG00000233348. [P46379-5]
ENST00000552605; ENSP00000446525; ENSG00000096155. [P46379-5]
ENST00000613474; ENSP00000478966; ENSG00000227761. [P46379-4]
ENST00000615143; ENSP00000482413; ENSG00000229524. [P46379-4]
ENST00000615224; ENSP00000477951; ENSG00000228760. [P46379-4]
ENST00000615725; ENSP00000479238; ENSG00000233348. [P46379-4]
ENST00000617635; ENSP00000484238; ENSG00000096155. [P46379-4]
ENST00000621056; ENSP00000477867; ENSG00000234651. [P46379-4]
GeneIDi7917.
KEGGihsa:7917.
UCSCiuc003nvf.4. human. [P46379-1]

Organism-specific databases

CTDi7917.
DisGeNETi7917.
GeneCardsiBAG6.
H-InvDBiHIX0165051.
HIX0166179.
HIX0166289.
HIX0166578.
HIX0166832.
HIX0167081.
HIX0167222.
HIX0167321.
HIX0167461.
HIX0167568.
HGNCiHGNC:13919. BAG6.
HPAiCAB020704.
HPA045116.
HPA053291.
MIMi142590. gene.
neXtProtiNX_P46379.
OpenTargetsiENSG00000204463.
PharmGKBiPA25264.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4248. Eukaryota.
ENOG410XS9P. LUCA.
GeneTreeiENSGT00390000016199.
HOVERGENiHBG002193.
InParanoidiP46379.
OMAiPFIERTH.
OrthoDBiEOG091G0XSR.
PhylomeDBiP46379.
TreeFamiTF328437.

Miscellaneous databases

ChiTaRSiBAG6. human.
EvolutionaryTraceiP46379.
GeneWikiiHLA-B_associated_transcript_3.
GenomeRNAii7917.
PMAP-CutDBiB0UX84.
PROiPR:P46379.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000096155.
ExpressionAtlasiP46379. baseline and differential.
GenevisibleiP46379. HS.

Family and domain databases

InterProiView protein in InterPro
IPR021925. DUF3538.
IPR029071. Ubiquitin-rel_dom.
IPR019954. Ubiquitin_CS.
IPR000626. Ubiquitin_dom.
PfamiView protein in Pfam
PF12057. DUF3538. 1 hit.
PF00240. ubiquitin. 1 hit.
SMARTiView protein in SMART
SM00213. UBQ. 1 hit.
SUPFAMiSSF54236. SSF54236. 1 hit.
PROSITEiView protein in PROSITE
PS00299. UBIQUITIN_1. 1 hit.
PS50053. UBIQUITIN_2. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiBAG6_HUMAN
AccessioniPrimary (citable) accession number: P46379
Secondary accession number(s): A2ADJ7
, A3KQ42, A3KQ44, A6NGY6, A6PWF7, B0UX84, B4DZ12, B4E3V4, E7EMZ4, F8VXY4, O95874, Q5HYL9, Q5SQ35, Q5SQ36, Q5SQ37, Q5SQ41, Q5SRP8, Q5SRP9, Q5STC1, Q5STX1, Q5STX3, Q96SA6, Q9BCN4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: September 27, 2005
Last modified: April 12, 2017
This is version 163 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.