P46020 (KPB1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 125.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform Short name=Phosphorylase kinase alpha M subunit | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1223 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Phosphorylase b kinase catalyzes the phosphorylation of serine in certain substrates, including troponin I. The alpha chain may bind calmodulin. |
| Enzyme regulation | By phosphorylation of various serine residues. Allosteric regulation by calcium. |
| Pathway | |
| Subunit structure | Hexadecamer of 4 heterotetramers, each composed of alpha, beta, gamma, and delta subunits. Alpha (PHKA1 or PHKA2) and beta (PHKB) are regulatory subunits, gamma (PHKG1 or PHKG2) is the catalytic subunit, and delta is calmodulin. |
| Subcellular location | Cell membrane; Lipid-anchor; Cytoplasmic side Potential. |
| Tissue specificity | Muscle specific. Isoform 1 is predominant in vastus lateralis muscle. Isoform 2 predominates slightly in heart, and it predominates clearly in the other tissues tested. |
| Post-translational modification | Although the final Cys may be farnesylated, the terminal tripeptide is probably not removed, and the C-terminus is not methylated By similarity. |
| Involvement in disease | Glycogen storage disease 9D (GSD9D) [MIM:300559]: A metabolic disorder characterized by slowly progressive, predominantly distal muscle weakness and atrophy. Clinical features include exercise intolerance with early fatigability, pain, cramps and occasionally myoglobinuria. |
| Sequence similarities | Belongs to the phosphorylase b kinase regulatory chain family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Carbohydrate metabolism Glycogen metabolism |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Disease | Disease mutation Glycogen storage disease |
| Ligand | Calmodulin-binding |
| Molecular function | Muscle protein |
| PTM | Lipoprotein Phosphoprotein Prenylation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | glucose metabolic process Traceable author statement. Source: Reactome glycogen catabolic processTraceable author statement. Source: Reactome small molecule metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | hydrolase activity, hydrolyzing O-glycosyl compounds Inferred from electronic annotation. Source: InterPro phosphorylase kinase activityTraceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P46020-1) Also known as: AC; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P46020-2) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 1012-1024: Missing. | ||||||
| Isoform 3 (identifier: P46020-3) The sequence of this isoform differs from the canonical sequence as follows: 654-713: ARCGDEVARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQN → D 1011-1023: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1223 | 1223 | Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform | PRO_0000057726 | |||||
Regions | |||||||||
| Region | 810 – 840 | 31 | Calmodulin-binding Potential | ||||||
| Region | 1046 – 1086 | 41 | Calmodulin-binding Potential | ||||||
Sites | |||||||||
| Site | 1220 | 1 | Not methylated | ||||||
Amino acid modifications | |||||||||
| Modified residue | 200 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 201 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 735 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 758 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 972 | 1 | Phosphoserine Ref.5 Ref.6 | ||||||
| Modified residue | 985 | 1 | Phosphoserine Ref.5 Ref.6 | ||||||
| Modified residue | 1007 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||
| Modified residue | 1018 | 1 | Phosphoserine; by PKA By similarity | ||||||
| Modified residue | 1020 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1023 | 1 | Phosphoserine By similarity | ||||||
| Lipidation | 1220 | 1 | S-farnesyl cysteine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 654 – 713 | 60 | ARCGD…LHVQN → D in isoform 3. | VSP_042517 | |||||
| Alternative sequence | 1011 – 1023 | 13 | Missing in isoform 3. | VSP_042518 | |||||
| Alternative sequence | 1012 – 1024 | 13 | Missing in isoform 2. | VSP_004697 | |||||
| Natural variant | 299 | 1 | D → V in GSD9D. Ref.8 | VAR_020856 | |||||
Experimental info | |||||||||
| Sequence conflict | 568 | 1 | H → Y in CAA52083. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The multiphosphorylation domain of the phosphorylase kinase alpha M and alpha L subunits is a hotspot of differential mRNA processing and of molecular evolution." Wuellrich A., Hamacher C., Schneider A., Kilimann M.W. J. Biol. Chem. 268:23208-23214(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Muscle. |
| [2] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Brain. |
| [4] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-735, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [5] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-972 AND SER-985, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [6] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-758; SER-972 AND SER-985, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [8] | "Muscle glycogenosis with low phosphorylase kinase activity: mutations in PHKA1, PHKG1 or six other candidate genes explain only a minority of cases." Burwinkel B., Hu B., Schroers A., Clemens P.R., Moses S.W., Shin Y.S., Pongratz D., Vorgerd M., Kilimann M.W. Eur. J. Hum. Genet. 11:516-526(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GSD9D VAL-299. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X73874 mRNA. Translation: CAA52083.1. BX295541 Genomic DNA. No translation available. BX295542 Genomic DNA. No translation available. BC104944 mRNA. Translation: AAI04945.1. BC143499 mRNA. Translation: AAI43500.1. BC143501 mRNA. Translation: AAI43502.1. |
| IPI | IPI00004247. IPI00216725. IPI00446678. |
| PIR | I38111. |
| RefSeq | NP_001116142.1. NM_001122670.1. NP_001165907.1. NM_001172436.1. NP_002628.2. NM_002637.3. |
| UniGene | Hs.201379. |
3D structure databases | |
| ProteinModelPortal | P46020. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P46020. 2 interactions. |
| STRING | 9606.ENSP00000362643. |
PTM databases | |
| PhosphoSite | P46020. |
Polymorphism databases | |
| DMDM | 110282976. |
Proteomic databases | |
| PaxDb | P46020. |
| PRIDE | P46020. |
Protocols and materials databases | |
| DNASU | 5255. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000339490; ENSP00000342469; ENSG00000067177. ENST00000373542; ENSP00000362643; ENSG00000067177. ENST00000541944; ENSP00000441251; ENSG00000067177. ENST00000593378; ENSP00000471521; ENSG00000268579. ENST00000600891; ENSP00000471771; ENSG00000268579. ENST00000601371; ENSP00000472984; ENSG00000268579. |
| GeneID | 5255. |
| KEGG | hsa:5255. |
| UCSC | uc004eax.4. human. uc004eay.4. human. uc011mqi.2. human. |
Organism-specific databases | |
| CTD | 5255. |
| GeneCards | GC0XM071715. |
| HGNC | HGNC:8925. PHKA1. |
| HPA | HPA001081. |
| MIM | 300559. phenotype. 311870. gene. |
| neXtProt | NX_P46020. |
| Orphanet | 715. Glycogen storage disease due to muscle phosphorylase kinase deficiency. |
| PharmGKB | PA33266. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG82518. |
| HOGENOM | HOG000231478. |
| HOVERGEN | HBG000273. |
| KO | K07190. |
| OrthoDB | EOG4ZPDTH. |
| PhylomeDB | P46020. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS00901-MONOMER. |
| BRENDA | 2.7.11.19. 2681. |
| Reactome | REACT_111217. Metabolism. |
| UniPathway | UPA00163. |
Gene expression databases | |
| ArrayExpress | P46020. |
| Bgee | P46020. |
| CleanEx | HS_PHKA1. |
| Genevestigator | P46020. |
| GermOnline | ENSG00000067177. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.50.10.10. 1 hit. |
| InterPro | IPR008928. 6-hairpin_glycosidase-like. IPR012341. 6hp_glycosidase. IPR011613. Glyco_hydro_15. IPR008734. PHK_A/B_su. [Graphical view] |
| PANTHER | PTHR10749. PTHR10749. 1 hit. |
| Pfam | PF00723. Glyco_hydro_15. 1 hit. [Graphical view] |
| SUPFAM | SSF48208. Glyco_trans_6hp. 1 hit. |
| ProtoNet | Search... |
Other | |
| BindingDB | P46020. |
| ChEMBL | CHEMBL2905. |
| ChiTaRS | PHKA1. human. |
| GenomeRNAi | 5255. |
| NextBio | 20300. |
| SOURCE | Search... |
Entry information
| Entry name | KPB1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P46020 Secondary accession number(s): B7ZL05, B7ZL07, Q2M3D7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
