P43322 (NRG1_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pro-neuregulin-1, membrane-bound isoform Short name=Pro-NRG1 Cleaved into the following chain:
| ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 662 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vessicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart By similarity. Ref.6 |
| Subunit structure | The cytoplasmic domain interacts with the LIM domain region of LIMK1. Interacts with ERBB3 and ERBB4. Ref.5 |
| Subcellular location | Pro-neuregulin-1, membrane-bound isoform: Cell membrane; Single-pass type I membrane protein. Note: Does not seem to be active. |
| Tissue specificity | Widely expressed. Most tissues contain isoform alpha2A and isoform alpha2B. Isoform Alpha2 and isoform beta2 are the predominant forms in mesenchymal and non-neuronal organs. Isoform Beta1 is enriched in brain and spinal cord, but not in muscle and heart. Isoform Alpha2C is highly expressed in spinal cord, moderately in lung, brain, ovary, and stomach, in low amounts in the kidney, skin and heart and not detected in the liver, spleen, and placenta. |
| Domain | The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization. ERBB receptor binding is elicited entirely by the EGF-like domain. |
| Post-translational modification | Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form. N- and O-glycosylated By similarity. Extensive glycosylation precedes the proteolytic cleavage. |
| Sequence similarities | Belongs to the neuregulin family. Contains 1 EGF-like domain. Contains 1 Ig-like C2-type (immunoglobulin-like) domain. |
Ontologies
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform Beta4 (identifier: P43322-1) Also known as: NDF42A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Alpha2A (identifier: P43322-2) Also known as: NDF38; The sequence of this isoform differs from the canonical sequence as follows: 213-256: PNEFTGDRCQNYVMASFYMTSRRKRQETEKPLERKLDHSLVKES → QPGFTGARCTENVPMKVQTQE | ||||||
| Isoform Alpha2B (identifier: P43322-3) Also known as: NDF19; The sequence of this isoform differs from the canonical sequence as follows: 213-256: PNEFTGDRCQNYVMASFYMTSRRKRQETEKPLERKLDHSLVKES → QPGFTGARCTENVPMKVQTQE 446-484: YVSAMTTPAR...SPPVSSMTVS → HNLIAELRRN...SSITHLGFIL 485-662: Missing. | ||||||
| Isoform Alpha2C (identifier: P43322-4) Also known as: NDF44; The sequence of this isoform differs from the canonical sequence as follows: 213-256: PNEFTGDRCQNYVMASFYMTSRRKRQETEKPLERKLDHSLVKES → QPGFTGARCTENVPMKVQTQE 446-662: Missing. | ||||||
| Isoform Beta1 (identifier: P43322-5) The sequence of this isoform differs from the canonical sequence as follows: 231-257: MTSRRKRQETEKPLERKLDHSLVKESK → KHLGIEFME | ||||||
| Isoform Beta2 (identifier: P43322-6) Also known as: NDF40; The sequence of this isoform differs from the canonical sequence as follows: 231-256: Missing. 325-330: PPENVQ → RVRTRG | ||||||
| Isoform BetA2A (identifier: P43322-7) Also known as: NDF22; The sequence of this isoform differs from the canonical sequence as follows: 231-256: Missing. | ||||||
| Isoform Beta3 (identifier: P43322-8) Also known as: NDF4; The sequence of this isoform differs from the canonical sequence as follows: 231-241: MTSRRKRQETE → STSTPFLSLPE 242-662: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||||
| Propeptide | 2 – 13 | 12 | PRO_0000019465 | ||||||||
| Chain | 14 – 662 | 649 | Pro-neuregulin-1, membrane-bound isoform | PRO_0000019466 | |||||||
| Chain | 14 – 264 | 251 | Neuregulin-1 | PRO_0000019467 | |||||||
Regions | |||||||||||
| Topological domain | 14 – 265 | 252 | Extracellular Potential | ||||||||
| Transmembrane | 266 – 288 | 23 | Helical; Note=Internal signal sequence; Potential | ||||||||
| Topological domain | 289 – 662 | 374 | Cytoplasmic Potential | ||||||||
| Domain | 37 – 128 | 92 | Ig-like C2-type | ||||||||
| Domain | 178 – 222 | 45 | EGF-like | ||||||||
| Compositional bias | 165 – 177 | 13 | Ser/Thr-rich | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 120 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 126 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 164 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 57 ↔ 112 | ||||||||||
| Disulfide bond | 182 ↔ 196 | By similarity | |||||||||
| Disulfide bond | 190 ↔ 210 | By similarity | |||||||||
| Disulfide bond | 212 ↔ 221 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 213 – 256 | 44 | PNEFT…LVKES → QPGFTGARCTENVPMKVQTQ E in isoform Alpha2A, isoform Alpha2B and isoform Alpha2C. | VSP_003436 | |||||||
| Alternative sequence | 231 – 257 | 27 | MTSRR…VKESK → KHLGIEFME in isoform Beta1. | VSP_003437 | |||||||
| Alternative sequence | 231 – 256 | 26 | Missing in isoform Beta2 and isoform BetA2A. | VSP_003440 | |||||||
| Alternative sequence | 231 – 241 | 11 | MTSRRKRQETE → STSTPFLSLPE in isoform Beta3. | VSP_003438 | |||||||
| Alternative sequence | 242 – 662 | 421 | Missing in isoform Beta3. | VSP_003439 | |||||||
| Alternative sequence | 325 – 330 | 6 | PPENVQ → RVRTRG in isoform Beta2. | VSP_003441 | |||||||
| Alternative sequence | 446 – 662 | 217 | Missing in isoform Alpha2C. | VSP_003442 | |||||||
| Alternative sequence | 446 – 484 | 39 | YVSAM…SMTVS → HNLIAELRRNKAYRSKCMQI QLSATHLRPSSITHLGFIL in isoform Alpha2B. | VSP_003443 | |||||||
| Alternative sequence | 485 – 662 | 178 | Missing in isoform Alpha2B. | VSP_003444 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 90 | 1 | K → N AA sequence Ref.2 | ||||||||
| Sequence conflict | 137 | 1 | T → I AA sequence Ref.2 | ||||||||
| Sequence conflict | 208 | 1 | Y → S AA sequence Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Structural and functional aspects of the multiplicity of Neu differentiation factors." Wen D., Suggs S.V., Karunagaran D., Liu N., Cupples R.L., Luo Y., Janssen A.M., Ben-Baruch N., Trollinger D.B., Jacobsen V.L., Meng S.-Y., Lu H.S., Hu S., Chang D., Yang W., Yanigahara D., Koski R.A., Yarden Y. Mol. Cell. Biol. 14:1909-1919(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. Tissue: Fibroblast. |
| [2] | "Neu differentiation factor: a transmembrane glycoprotein containing an EGF domain and an immunoglobulin homology unit." Wen D., Peles E., Cupples R., Suggs S.V., Bacus S.S., Luo Y., Trail G., Hu S., Silbiger S.M., Levy R.B., Koski R.A., Lu H.S., Yarden Y. Cell 69:559-572(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA2C), PARTIAL PROTEIN SEQUENCE. Tissue: Fibroblast. |
| [3] | "Isolation of the neu/HER-2 stimulatory ligand: a 44 kd glycoprotein that induces differentiation of mammary tumor cells." Peles E., Bacus S.S., Koski R.A., Lu H.S., Wen D., Ogden S.G., Levy R.B., Yarden Y. Cell 69:205-216(1992) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 14-36. |
| [4] | "Release of the neuregulin functional polypeptide requires its cytoplasmic tail." Liu X., Hwang H., Cao L., Wen D., Liu N., Graham R.M., Zhou M. J. Biol. Chem. 273:34335-34340(1998) [PubMed] [Europe PMC] [Abstract] Cited for: REGULATION OF PROCESSING (ISOFORM ALPHA2C). |
| [5] | "Transmembrane neuregulins interact with LIM kinase 1, a cytoplasmic protein kinase implicated in development of visuospatial cognition." Wang J.Y., Frenzel K.E., Wen D., Falls D.L. J. Biol. Chem. 273:20525-20534(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH LIMK1. |
| [6] | "Stimulated ErbB4 internalization is necessary for neuregulin signaling in neurons." Liu Y., Tao Y.M., Woo R.S., Xiong W.C., Mei L. Biochem. Biophys. Res. Commun. 354:505-510(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U02315 mRNA. Translation: AAA19940.1. U02316 mRNA. Translation: AAA19941.1. U02317 mRNA. Translation: AAA19942.1. U02318 mRNA. Translation: AAA19943.1. U02319 mRNA. Translation: AAA19944.1. U02320 mRNA. Translation: AAA19945.1. U02321 mRNA. Translation: AAA19946.1. U02322 mRNA. Translation: AAA19947.1. U02323 mRNA. Translation: AAA19948.1. U02324 mRNA. Translation: AAA19949.1. M92430 mRNA. No translation available. |
| IPI | IPI00199399. IPI00231479. IPI00231480. IPI00231481. IPI00231482. IPI00231483. IPI00231485. IPI00325778. |
| PIR | I61718. I61719. I61722. |
| RefSeq | NP_001258052.1. NM_001271123.1. |
| UniGene | Rn.37438. |
3D structure databases | |
| ProteinModelPortal | P43322. |
| SMR | P43322. Positions 177-225. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P43322. |
Proteomic databases | |
| PaxDb | P43322. |
| PRIDE | P43322. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 112400. |
| KEGG | rno:112400. |
| UCSC | RGD:621341. rat. |
Organism-specific databases | |
| CTD | 3084. |
| RGD | 621341. Nrg1. |
Phylogenomic databases | |
| eggNOG | NOG47801. |
| HOVERGEN | HBG006531. |
| KO | K05455. |
| OrthoDB | EOG42Z4PT. |
Gene expression databases | |
| ArrayExpress | P43322. |
| Genevestigator | P43322. |
| GermOnline | ENSRNOG00000010392. Rattus norvegicus. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 1 hit. |
| InterPro | IPR000742. EG-like_dom. IPR013032. EGF-like_CS. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003598. Ig_sub2. IPR018250. Neuregulin. IPR002154. Neuregulin_1_C. [Graphical view] |
| Pfam | PF07679. I-set. 1 hit. PF02158. Neuregulin. 1 hit. [Graphical view] |
| PRINTS | PR01089. NEUREGULIN. |
| SMART | SM00181. EGF. 1 hit. SM00408. IGc2. 1 hit. [Graphical view] |
| PROSITE | PS00022. EGF_1. 1 hit. PS01186. EGF_2. False negative. PS50026. EGF_3. 1 hit. PS50835. IG_LIKE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 617943. |
Entry information
| Entry name | NRG1_RAT | ||||||||
| Accession | Primary (citable) accession number: P43322 Secondary accession number(s): P43323 P43328 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
