P43121 (MUC18_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cell surface glycoprotein MUC18 Alternative name(s): Cell surface glycoprotein P1H12 Melanoma cell adhesion molecule Melanoma-associated antigen A32 Melanoma-associated antigen MUC18 S-endo 1 endothelial-associated antigen CD_antigen=CD146 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 646 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration. Ref.9 Ref.10 |
| Subcellular location | |
| Tissue specificity | Detected in endothelial cells in vascular tissue throughout the body. May appear at the surface of neural crest cells during their embryonic migration. Appears to be limited to vascular smooth muscle in normal adult tissues. Associated with tumor progression and the development of metastasis in human malignant melanoma. Expressed most strongly on metastatic lesions and advanced primary tumors and is only rarely detected in benign melanocytic nevi and thin primary melanomas with a low probability of metastasis. |
| Sequence similarities | Contains 3 Ig-like C2-type (immunoglobulin-like) domains. Contains 2 Ig-like V-type (immunoglobulin-like) domains. |
| Sequence caution | The sequence BAD93162.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane Transmembrane helix |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | anatomical structure morphogenesis Traceable author statement. Source: ProtInc cell adhesionTraceable author statement. Source: ProtInc |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneNon-traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P43121-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P43121-2) The sequence of this isoform differs from the canonical sequence as follows: 1-187: MGLPRLVCAF...GRPLKEEKNR → MVYIVRQFLL...SLPPLPPCPG 549-646: ERKLPEPESR...QGEKYIDLRH → GKPGLAREQGCARASFLPCPSPESPVQKGE | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Ref.7 | ||||||||
| Chain | 24 – 646 | 623 | Cell surface glycoprotein MUC18 | PRO_0000014891 | |||||||
Regions | |||||||||||
| Topological domain | 24 – 559 | 536 | Extracellular Potential | ||||||||
| Transmembrane | 560 – 583 | 24 | Helical; Potential | ||||||||
| Topological domain | 584 – 646 | 63 | Cytoplasmic Potential | ||||||||
| Domain | 24 – 129 | 106 | Ig-like V-type 1 | ||||||||
| Domain | 139 – 242 | 104 | Ig-like V-type 2 | ||||||||
| Domain | 244 – 330 | 87 | Ig-like C2-type 1 | ||||||||
| Domain | 335 – 424 | 90 | Ig-like C2-type 2 | ||||||||
| Domain | 430 – 510 | 81 | Ig-like C2-type 3 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 606 | 1 | Phosphoserine Ref.12 | ||||||||
| Modified residue | 614 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||||
| Glycosylation | 56 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 418 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 449 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 467 | 1 | N-linked (GlcNAc...) Ref.13 | ||||||||
| Glycosylation | 508 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 518 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 527 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 544 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 48 ↔ 116 | Probable | |||||||||
| Disulfide bond | 161 ↔ 223 | Probable | |||||||||
| Disulfide bond | 272 ↔ 320 | Probable | |||||||||
| Disulfide bond | 365 ↔ 407 | Probable | |||||||||
| Disulfide bond | 452 ↔ 499 | Probable | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 187 | 187 | MGLPR…EEKNR → MVYIVRQFLLYNVSGSVYLD QLIVLLTAKFSILRIAGSRV HHSPFSGHLDGCSFLSLQHS LHTSLDMSRHENVFLGLTLS SKSAGLKGFQLAFVPGLLQG TGGYLDGPLPTPVDNPRVGL EVGLRLSLPPLPPCPG in isoform 2. | VSP_016938 | |||||||
| Alternative sequence | 549 – 646 | 98 | ERKLP…IDLRH → GKPGLAREQGCARASFLPCP SPESPVQKGE in isoform 2. | VSP_016939 | |||||||
| Natural variant | 89 | 1 | E → G. Ref.5 Corresponds to variant rs34587557 [ dbSNP | Ensembl ]. | VAR_049915 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 322 – 324 | 3 | GLD → AWN Ref.1 | ||||||||
| Sequence conflict | 322 – 324 | 3 | GLD → AWN Ref.2 | ||||||||
| Sequence conflict | 383 | 1 | G → D Ref.1 | ||||||||
| Sequence conflict | 383 | 1 | G → D Ref.2 | ||||||||
| Sequence conflict | 383 | 1 | G → D Ref.3 | ||||||||
| Sequence conflict | 424 – 425 | 2 | NV → KL Ref.1 | ||||||||
| Sequence conflict | 424 – 425 | 2 | NV → KL Ref.2 | ||||||||
| Sequence conflict | 606 | 1 | S → T Ref.1 | ||||||||
| Sequence conflict | 606 | 1 | S → T Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "MUC18, a marker of tumor progression in human melanoma, shows sequence similarity to the neural cell adhesion molecules of the immunoglobulin superfamily." Lehmann J.M., Riethmueller G., Johnson J.P. Proc. Natl. Acad. Sci. U.S.A. 86:9891-9895(1989) [PubMed: 2602381] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Melanoma. |
| [2] | "Genomic organization of the melanoma-associated glycoprotein MUC18: implications for the evolution of the immunoglobulin domains." Sers C., Kirsch K., Rothbaecher U., Riethmueller G., Johnson J.P. Proc. Natl. Acad. Sci. U.S.A. 90:8514-8518(1993) [PubMed: 8378324] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), SEQUENCE REVISION. Tissue: Melanoma. |
| [3] | "Identification and functional assessment of endothelial P1H12." Solovey A.N., Gui L., Chang L., Enenstein J., Browne P.V., Hebbel R.P. J. Lab. Clin. Med. 138:322-331(2001) [PubMed: 11709656] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Trachea. |
| [5] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-89. Tissue: Aortic endothelium. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: PNS. |
| [7] | "Isolation and functional characterization of the A32 melanoma-associated antigen." Shih I.-M., Eleder D.E., Speicher D., Johnson J.P., Herlyn M. Cancer Res. 54:2514-2520(1994) [PubMed: 8162602] [Abstract] Cited for: PROTEIN SEQUENCE OF 24-44; 98-112; 135-153; 240-260; 379-389 AND 460-478. |
| [8] | "Identification of the S-endo 1 endothelial-associated antigen." Bardin N., Frances V., Lesaule G., Horschowski N., George F., Sampol J. Biochem. Biophys. Res. Commun. 218:210-216(1996) [PubMed: 8573133] [Abstract] Cited for: PROTEIN SEQUENCE OF 27-40; 98-112 AND 236-260. |
| [9] | "The progression associated antigen MUC18: a unique member of the immunoglobulin supergene family." Johnson J.P., Rothbacher U., Sers C. Melanoma Res. 3:337-340(1993) [PubMed: 8292890] [Abstract] Cited for: FUNCTION. |
| [10] | "Outside-in signaling pathway linked to CD146 engagement in human endothelial cells." Anfosso F., Bardin N., Vivier E., Sabatier F., Sampol J., Dignat-George F. J. Biol. Chem. 276:1564-1569(2001) [PubMed: 11036077] [Abstract] Cited for: FUNCTION. |
| [11] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-614, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-606 AND SER-614, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-467, MASS SPECTROMETRY. Tissue: Liver. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M29277 mRNA. Translation: AAA20824.1. M28882 mRNA. Translation: AAA20922.1. X68264 X68271 Genomic DNA. Translation: CAA48332.1.AF089868 mRNA. Translation: AAD17799.1. AK126303 mRNA. Translation: BAC86520.1. AB209925 mRNA. Translation: BAD93162.1. Different initiation. BC056418 mRNA. Translation: AAH56418.1. |
| IPI | IPI00016334. IPI00445227. |
| PIR | I38049. |
| RefSeq | NP_006491.2. NM_006500.2. |
| UniGene | Hs.599039. |
3D structure databases | |
| ProteinModelPortal | P43121. |
| SMR | P43121. Positions 24-518. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-52791N. |
| IntAct | P43121. 1 interaction. |
| MINT | MINT-1184800. |
| STRING | P43121. |
PTM databases | |
| PhosphoSite | P43121. |
Polymorphism databases | |
| DMDM | 85681878. |
Proteomic databases | |
| PeptideAtlas | P43121. |
| PRIDE | P43121. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000264036; ENSP00000264036; ENSG00000076706. |
| GeneID | 4162. |
| KEGG | hsa:4162. |
| UCSC | uc001pwf.1. human. |
Organism-specific databases | |
| CTD | 4162. |
| GeneCards | GC11M119179. |
| H-InvDB | HIX0026138. |
| HGNC | HGNC:6934. MCAM. |
| HPA | CAB002147. HPA008848. |
| MIM | 155735. gene. |
| neXtProt | NX_P43121. |
| PharmGKB | PA30678. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG08175. |
| GeneTree | ENSGT00530000063457. |
| HOGENOM | HBG444295. |
| HOVERGEN | HBG002808. |
| InParanoid | P43121. |
| OMA | RIQLRVY. |
| OrthoDB | EOG4ZGPBZ. |
| PhylomeDB | P43121. |
Gene expression databases | |
| ArrayExpress | P43121. |
| Bgee | P43121. |
| CleanEx | HS_MCAM. |
| Genevestigator | P43121. |
| GermOnline | ENSG00000076706. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR013162. CD80_C2-set. IPR007110. Ig-like. IPR013783. Ig-like_fold. IPR003599. Ig_sub. IPR003598. Ig_sub2. IPR013106. Ig_V-set. IPR013151. Immunoglobulin. [Graphical view] |
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 5 hits. |
| KO | K06534. |
| Pfam | PF08205. C2-set_2. 1 hit. PF00047. ig. 2 hits. PF07686. V-set. 1 hit. [Graphical view] |
| SMART | SM00409. IG. 1 hit. SM00408. IGc2. 2 hits. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 16398. |
| SOURCE | Search... |
Entry information
| Entry name | MUC18_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P43121 Secondary accession number(s): O95812 Q6ZTR2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with