Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P43121

- MUC18_HUMAN

UniProt

P43121 - MUC18_HUMAN

Protein

Cell surface glycoprotein MUC18

Gene

MCAM

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 135 (01 Oct 2014)
      Sequence version 2 (10 Jan 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration.2 Publications

    GO - Biological processi

    1. anatomical structure morphogenesis Source: ProtInc
    2. cell adhesion Source: ProtInc
    3. glomerular filtration Source: UniProtKB
    4. vascular wound healing Source: UniProtKB

    Keywords - Biological processi

    Cell adhesion

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cell surface glycoprotein MUC18
    Alternative name(s):
    Cell surface glycoprotein P1H12
    Melanoma cell adhesion molecule
    Melanoma-associated antigen A32
    Melanoma-associated antigen MUC18
    S-endo 1 endothelial-associated antigen
    CD_antigen: CD146
    Gene namesi
    Name:MCAM
    Synonyms:MUC18
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:6934. MCAM.

    Subcellular locationi

    GO - Cellular componenti

    1. external side of plasma membrane Source: UniProtKB
    2. integral component of membrane Source: UniProtKB-KW
    3. plasma membrane Source: ProtInc

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30678.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 23231 PublicationAdd
    BLAST
    Chaini24 – 646623Cell surface glycoprotein MUC18PRO_0000014891Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi48 ↔ 116Curated
    Glycosylationi56 – 561N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi161 ↔ 223Curated
    Disulfide bondi272 ↔ 320Curated
    Disulfide bondi365 ↔ 407Curated
    Glycosylationi418 – 4181N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi449 – 4491N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi452 ↔ 499Curated
    Glycosylationi467 – 4671N-linked (GlcNAc...)1 Publication
    Glycosylationi508 – 5081N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi518 – 5181N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi527 – 5271N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi544 – 5441N-linked (GlcNAc...)Sequence Analysis
    Modified residuei614 – 6141Phosphoserine2 Publications
    Modified residuei628 – 6281Phosphoserine1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiP43121.
    PaxDbiP43121.
    PeptideAtlasiP43121.
    PRIDEiP43121.

    PTM databases

    PhosphoSiteiP43121.

    Expressioni

    Tissue specificityi

    Detected in endothelial cells in vascular tissue throughout the body. May appear at the surface of neural crest cells during their embryonic migration. Appears to be limited to vascular smooth muscle in normal adult tissues. Associated with tumor progression and the development of metastasis in human malignant melanoma. Expressed most strongly on metastatic lesions and advanced primary tumors and is only rarely detected in benign melanocytic nevi and thin primary melanomas with a low probability of metastasis.

    Gene expression databases

    BgeeiP43121.
    CleanExiHS_MCAM.
    GenevestigatoriP43121.

    Organism-specific databases

    HPAiCAB002147.
    HPA008848.

    Interactioni

    Protein-protein interaction databases

    BioGridi110332. 5 interactions.
    DIPiDIP-52791N.
    IntActiP43121. 3 interactions.
    MINTiMINT-1184800.
    STRINGi9606.ENSP00000264036.

    Structurei

    3D structure databases

    ProteinModelPortaliP43121.
    SMRiP43121. Positions 27-510.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini24 – 559536ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini584 – 64663CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei560 – 58324HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini24 – 129106Ig-like V-type 1Add
    BLAST
    Domaini139 – 242104Ig-like V-type 2Add
    BLAST
    Domaini244 – 33087Ig-like C2-type 1Add
    BLAST
    Domaini335 – 42490Ig-like C2-type 2Add
    BLAST
    Domaini430 – 51081Ig-like C2-type 3Add
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG116686.
    HOGENOMiHOG000015427.
    HOVERGENiHBG002808.
    InParanoidiP43121.
    KOiK06534.
    OMAiDQGEKYI.
    OrthoDBiEOG7RFTH4.
    PhylomeDBiP43121.
    TreeFamiTF330534.

    Family and domain databases

    Gene3Di2.60.40.10. 5 hits.
    InterProiIPR013162. CD80_C2-set.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR013106. Ig_V-set.
    IPR013151. Immunoglobulin.
    [Graphical view]
    PfamiPF08205. C2-set_2. 1 hit.
    PF00047. ig. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view]
    SMARTiSM00409. IG. 1 hit.
    SM00408. IGc2. 2 hits.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 5 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P43121-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGLPRLVCAF LLAACCCCPR VAGVPGEAEQ PAPELVEVEV GSTALLKCGL    50
    SQSQGNLSHV DWFSVHKEKR TLIFRVRQGQ GQSEPGEYEQ RLSLQDRGAT 100
    LALTQVTPQD ERIFLCQGKR PRSQEYRIQL RVYKAPEEPN IQVNPLGIPV 150
    NSKEPEEVAT CVGRNGYPIP QVIWYKNGRP LKEEKNRVHI QSSQTVESSG 200
    LYTLQSILKA QLVKEDKDAQ FYCELNYRLP SGNHMKESRE VTVPVFYPTE 250
    KVWLEVEPVG MLKEGDRVEI RCLADGNPPP HFSISKQNPS TREAEEETTN 300
    DNGVLVLEPA RKEHSGRYEC QGLDLDTMIS LLSEPQELLV NYVSDVRVSP 350
    AAPERQEGSS LTLTCEAESS QDLEFQWLRE ETGQVLERGP VLQLHDLKRE 400
    AGGGYRCVAS VPSIPGLNRT QLVNVAIFGP PWMAFKERKV WVKENMVLNL 450
    SCEASGHPRP TISWNVNGTA SEQDQDPQRV LSTLNVLVTP ELLETGVECT 500
    ASNDLGKNTS ILFLELVNLT TLTPDSNTTT GLSTSTASPH TRANSTSTER 550
    KLPEPESRGV VIVAVIVCIL VLAVLGAVLY FLYKKGKLPC RRSGKQEITL 600
    PPSRKSELVV EVKSDKLPEE MGLLQGSSGD KRAPGDQGEK YIDLRH 646
    Length:646
    Mass (Da):71,607
    Last modified:January 10, 2006 - v2
    Checksum:iE46CB8AC7BA0738E
    GO
    Isoform 2 (identifier: P43121-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-187: MGLPRLVCAF...GRPLKEEKNR → MVYIVRQFLL...SLPPLPPCPG
         549-646: ERKLPEPESR...QGEKYIDLRH → GKPGLAREQGCARASFLPCPSPESPVQKGE

    Note: No experimental confirmation available.

    Show »
    Length:527
    Mass (Da):57,605
    Checksum:i68F5C36C5FFD36D6
    GO

    Sequence cautioni

    The sequence BAD93162.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti322 – 3243GLD → AWN(PubMed:2602381)Curated
    Sequence conflicti322 – 3243GLD → AWN(PubMed:8378324)Curated
    Sequence conflicti383 – 3831G → D(PubMed:2602381)Curated
    Sequence conflicti383 – 3831G → D(PubMed:8378324)Curated
    Sequence conflicti383 – 3831G → D(PubMed:11709656)Curated
    Sequence conflicti424 – 4252NV → KL(PubMed:2602381)Curated
    Sequence conflicti424 – 4252NV → KL(PubMed:8378324)Curated
    Sequence conflicti606 – 6061S → T(PubMed:2602381)Curated
    Sequence conflicti606 – 6061S → T(PubMed:8378324)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti89 – 891E → G.1 Publication
    Corresponds to variant rs34587557 [ dbSNP | Ensembl ].
    VAR_049915

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 187187MGLPR…EEKNR → MVYIVRQFLLYNVSGSVYLD QLIVLLTAKFSILRIAGSRV HHSPFSGHLDGCSFLSLQHS LHTSLDMSRHENVFLGLTLS SKSAGLKGFQLAFVPGLLQG TGGYLDGPLPTPVDNPRVGL EVGLRLSLPPLPPCPG in isoform 2. 1 PublicationVSP_016938Add
    BLAST
    Alternative sequencei549 – 64698ERKLP…IDLRH → GKPGLAREQGCARASFLPCP SPESPVQKGE in isoform 2. 1 PublicationVSP_016939Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M29277 mRNA. Translation: AAA20824.1.
    M28882 mRNA. Translation: AAA20922.1.
    X68264
    , X68265, X68266, X68267, X68268, X68270, X68271 Genomic DNA. Translation: CAA48332.1.
    AF089868 mRNA. Translation: AAD17799.1.
    AK126303 mRNA. Translation: BAC86520.1.
    AB209925 mRNA. Translation: BAD93162.1. Different initiation.
    BC056418 mRNA. Translation: AAH56418.1.
    CCDSiCCDS31690.1. [P43121-1]
    PIRiI38049.
    RefSeqiNP_006491.2. NM_006500.2. [P43121-1]
    UniGeneiHs.599039.

    Genome annotation databases

    EnsembliENST00000264036; ENSP00000264036; ENSG00000076706. [P43121-1]
    GeneIDi4162.
    KEGGihsa:4162.
    UCSCiuc001pwf.3. human. [P43121-1]

    Polymorphism databases

    DMDMi85681878.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M29277 mRNA. Translation: AAA20824.1 .
    M28882 mRNA. Translation: AAA20922.1 .
    X68264
    , X68265 , X68266 , X68267 , X68268 , X68270 , X68271 Genomic DNA. Translation: CAA48332.1 .
    AF089868 mRNA. Translation: AAD17799.1 .
    AK126303 mRNA. Translation: BAC86520.1 .
    AB209925 mRNA. Translation: BAD93162.1 . Different initiation.
    BC056418 mRNA. Translation: AAH56418.1 .
    CCDSi CCDS31690.1. [P43121-1 ]
    PIRi I38049.
    RefSeqi NP_006491.2. NM_006500.2. [P43121-1 ]
    UniGenei Hs.599039.

    3D structure databases

    ProteinModelPortali P43121.
    SMRi P43121. Positions 27-510.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110332. 5 interactions.
    DIPi DIP-52791N.
    IntActi P43121. 3 interactions.
    MINTi MINT-1184800.
    STRINGi 9606.ENSP00000264036.

    PTM databases

    PhosphoSitei P43121.

    Polymorphism databases

    DMDMi 85681878.

    Proteomic databases

    MaxQBi P43121.
    PaxDbi P43121.
    PeptideAtlasi P43121.
    PRIDEi P43121.

    Protocols and materials databases

    DNASUi 4162.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000264036 ; ENSP00000264036 ; ENSG00000076706 . [P43121-1 ]
    GeneIDi 4162.
    KEGGi hsa:4162.
    UCSCi uc001pwf.3. human. [P43121-1 ]

    Organism-specific databases

    CTDi 4162.
    GeneCardsi GC11M119179.
    HGNCi HGNC:6934. MCAM.
    HPAi CAB002147.
    HPA008848.
    MIMi 155735. gene.
    neXtProti NX_P43121.
    PharmGKBi PA30678.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG116686.
    HOGENOMi HOG000015427.
    HOVERGENi HBG002808.
    InParanoidi P43121.
    KOi K06534.
    OMAi DQGEKYI.
    OrthoDBi EOG7RFTH4.
    PhylomeDBi P43121.
    TreeFami TF330534.

    Miscellaneous databases

    ChiTaRSi MCAM. human.
    GeneWikii CD146.
    GenomeRNAii 4162.
    NextBioi 16398.
    PROi P43121.
    SOURCEi Search...

    Gene expression databases

    Bgeei P43121.
    CleanExi HS_MCAM.
    Genevestigatori P43121.

    Family and domain databases

    Gene3Di 2.60.40.10. 5 hits.
    InterProi IPR013162. CD80_C2-set.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR013106. Ig_V-set.
    IPR013151. Immunoglobulin.
    [Graphical view ]
    Pfami PF08205. C2-set_2. 1 hit.
    PF00047. ig. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view ]
    SMARTi SM00409. IG. 1 hit.
    SM00408. IGc2. 2 hits.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 5 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "MUC18, a marker of tumor progression in human melanoma, shows sequence similarity to the neural cell adhesion molecules of the immunoglobulin superfamily."
      Lehmann J.M., Riethmueller G., Johnson J.P.
      Proc. Natl. Acad. Sci. U.S.A. 86:9891-9895(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Melanoma.
    2. "Genomic organization of the melanoma-associated glycoprotein MUC18: implications for the evolution of the immunoglobulin domains."
      Sers C., Kirsch K., Rothbaecher U., Riethmueller G., Johnson J.P.
      Proc. Natl. Acad. Sci. U.S.A. 90:8514-8518(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), SEQUENCE REVISION.
      Tissue: Melanoma.
    3. "Identification and functional assessment of endothelial P1H12."
      Solovey A.N., Gui L., Chang L., Enenstein J., Browne P.V., Hebbel R.P.
      J. Lab. Clin. Med. 138:322-331(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Trachea.
    5. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-89.
      Tissue: Aortic endothelium.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: PNS.
    7. "Isolation and functional characterization of the A32 melanoma-associated antigen."
      Shih I.-M., Eleder D.E., Speicher D., Johnson J.P., Herlyn M.
      Cancer Res. 54:2514-2520(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 24-44; 98-112; 135-153; 240-260; 379-389 AND 460-478.
    8. Cited for: PROTEIN SEQUENCE OF 27-40; 98-112 AND 236-260.
    9. "The progression associated antigen MUC18: a unique member of the immunoglobulin supergene family."
      Johnson J.P., Rothbacher U., Sers C.
      Melanoma Res. 3:337-340(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    10. "Outside-in signaling pathway linked to CD146 engagement in human endothelial cells."
      Anfosso F., Bardin N., Vivier E., Sabatier F., Sampol J., Dignat-George F.
      J. Biol. Chem. 276:1564-1569(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-614, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-467.
      Tissue: Liver.
    13. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-614 AND SER-628, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiMUC18_HUMAN
    AccessioniPrimary (citable) accession number: P43121
    Secondary accession number(s): O95812
    , Q59E86, Q6PHR3, Q6ZTR2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1995
    Last sequence update: January 10, 2006
    Last modified: October 1, 2014
    This is version 135 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3