Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P43121

- MUC18_HUMAN

UniProt

P43121 - MUC18_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cell surface glycoprotein MUC18

Gene

MCAM

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration.2 Publications

GO - Biological processi

  1. anatomical structure morphogenesis Source: ProtInc
  2. cell adhesion Source: ProtInc
  3. glomerular filtration Source: UniProtKB
  4. vascular wound healing Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Cell surface glycoprotein MUC18
Alternative name(s):
Cell surface glycoprotein P1H12
Melanoma cell adhesion molecule
Melanoma-associated antigen A32
Melanoma-associated antigen MUC18
S-endo 1 endothelial-associated antigen
CD_antigen: CD146
Gene namesi
Name:MCAM
Synonyms:MUC18
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:6934. MCAM.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini24 – 559536ExtracellularSequence AnalysisAdd
BLAST
Transmembranei560 – 58324HelicalSequence AnalysisAdd
BLAST
Topological domaini584 – 64663CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. external side of plasma membrane Source: UniProtKB
  2. focal adhesion Source: UniProtKB
  3. integral component of membrane Source: UniProtKB-KW
  4. plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30678.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 23231 PublicationAdd
BLAST
Chaini24 – 646623Cell surface glycoprotein MUC18PRO_0000014891Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi48 ↔ 116Curated
Glycosylationi56 – 561N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi161 ↔ 223Curated
Disulfide bondi272 ↔ 320Curated
Disulfide bondi365 ↔ 407Curated
Glycosylationi418 – 4181N-linked (GlcNAc...)Sequence Analysis
Glycosylationi449 – 4491N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi452 ↔ 499Curated
Glycosylationi467 – 4671N-linked (GlcNAc...)1 Publication
Glycosylationi508 – 5081N-linked (GlcNAc...)Sequence Analysis
Glycosylationi518 – 5181N-linked (GlcNAc...)Sequence Analysis
Glycosylationi527 – 5271N-linked (GlcNAc...)Sequence Analysis
Glycosylationi544 – 5441N-linked (GlcNAc...)Sequence Analysis
Modified residuei614 – 6141Phosphoserine2 Publications
Modified residuei628 – 6281Phosphoserine1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP43121.
PaxDbiP43121.
PeptideAtlasiP43121.
PRIDEiP43121.

PTM databases

PhosphoSiteiP43121.

Expressioni

Tissue specificityi

Detected in endothelial cells in vascular tissue throughout the body. May appear at the surface of neural crest cells during their embryonic migration. Appears to be limited to vascular smooth muscle in normal adult tissues. Associated with tumor progression and the development of metastasis in human malignant melanoma. Expressed most strongly on metastatic lesions and advanced primary tumors and is only rarely detected in benign melanocytic nevi and thin primary melanomas with a low probability of metastasis.

Gene expression databases

BgeeiP43121.
CleanExiHS_MCAM.
GenevestigatoriP43121.

Organism-specific databases

HPAiCAB002147.
HPA008848.

Interactioni

Protein-protein interaction databases

BioGridi110332. 12 interactions.
DIPiDIP-52791N.
IntActiP43121. 3 interactions.
MINTiMINT-1184800.
STRINGi9606.ENSP00000264036.

Structurei

3D structure databases

ProteinModelPortaliP43121.
SMRiP43121. Positions 27-510.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 129106Ig-like V-type 1Add
BLAST
Domaini139 – 242104Ig-like V-type 2Add
BLAST
Domaini244 – 33087Ig-like C2-type 1Add
BLAST
Domaini335 – 42490Ig-like C2-type 2Add
BLAST
Domaini430 – 51081Ig-like C2-type 3Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG116686.
GeneTreeiENSGT00530000063457.
HOGENOMiHOG000015427.
HOVERGENiHBG002808.
InParanoidiP43121.
KOiK06534.
OMAiDQGEKYI.
OrthoDBiEOG7RFTH4.
PhylomeDBiP43121.
TreeFamiTF330534.

Family and domain databases

Gene3Di2.60.40.10. 5 hits.
InterProiIPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR013151. Immunoglobulin.
[Graphical view]
PfamiPF08205. C2-set_2. 1 hit.
PF00047. ig. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
SM00408. IGc2. 2 hits.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P43121-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGLPRLVCAF LLAACCCCPR VAGVPGEAEQ PAPELVEVEV GSTALLKCGL
60 70 80 90 100
SQSQGNLSHV DWFSVHKEKR TLIFRVRQGQ GQSEPGEYEQ RLSLQDRGAT
110 120 130 140 150
LALTQVTPQD ERIFLCQGKR PRSQEYRIQL RVYKAPEEPN IQVNPLGIPV
160 170 180 190 200
NSKEPEEVAT CVGRNGYPIP QVIWYKNGRP LKEEKNRVHI QSSQTVESSG
210 220 230 240 250
LYTLQSILKA QLVKEDKDAQ FYCELNYRLP SGNHMKESRE VTVPVFYPTE
260 270 280 290 300
KVWLEVEPVG MLKEGDRVEI RCLADGNPPP HFSISKQNPS TREAEEETTN
310 320 330 340 350
DNGVLVLEPA RKEHSGRYEC QGLDLDTMIS LLSEPQELLV NYVSDVRVSP
360 370 380 390 400
AAPERQEGSS LTLTCEAESS QDLEFQWLRE ETGQVLERGP VLQLHDLKRE
410 420 430 440 450
AGGGYRCVAS VPSIPGLNRT QLVNVAIFGP PWMAFKERKV WVKENMVLNL
460 470 480 490 500
SCEASGHPRP TISWNVNGTA SEQDQDPQRV LSTLNVLVTP ELLETGVECT
510 520 530 540 550
ASNDLGKNTS ILFLELVNLT TLTPDSNTTT GLSTSTASPH TRANSTSTER
560 570 580 590 600
KLPEPESRGV VIVAVIVCIL VLAVLGAVLY FLYKKGKLPC RRSGKQEITL
610 620 630 640
PPSRKSELVV EVKSDKLPEE MGLLQGSSGD KRAPGDQGEK YIDLRH
Length:646
Mass (Da):71,607
Last modified:January 10, 2006 - v2
Checksum:iE46CB8AC7BA0738E
GO
Isoform 2 (identifier: P43121-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: MGLPRLVCAF...GRPLKEEKNR → MVYIVRQFLL...SLPPLPPCPG
     549-646: ERKLPEPESR...QGEKYIDLRH → GKPGLAREQGCARASFLPCPSPESPVQKGE

Note: No experimental confirmation available.

Show »
Length:527
Mass (Da):57,605
Checksum:i68F5C36C5FFD36D6
GO

Sequence cautioni

The sequence BAD93162.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti322 – 3243GLD → AWN(PubMed:2602381)Curated
Sequence conflicti322 – 3243GLD → AWN(PubMed:8378324)Curated
Sequence conflicti383 – 3831G → D(PubMed:2602381)Curated
Sequence conflicti383 – 3831G → D(PubMed:8378324)Curated
Sequence conflicti383 – 3831G → D(PubMed:11709656)Curated
Sequence conflicti424 – 4252NV → KL(PubMed:2602381)Curated
Sequence conflicti424 – 4252NV → KL(PubMed:8378324)Curated
Sequence conflicti606 – 6061S → T(PubMed:2602381)Curated
Sequence conflicti606 – 6061S → T(PubMed:8378324)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti89 – 891E → G.1 Publication
Corresponds to variant rs34587557 [ dbSNP | Ensembl ].
VAR_049915

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 187187MGLPR…EEKNR → MVYIVRQFLLYNVSGSVYLD QLIVLLTAKFSILRIAGSRV HHSPFSGHLDGCSFLSLQHS LHTSLDMSRHENVFLGLTLS SKSAGLKGFQLAFVPGLLQG TGGYLDGPLPTPVDNPRVGL EVGLRLSLPPLPPCPG in isoform 2. 1 PublicationVSP_016938Add
BLAST
Alternative sequencei549 – 64698ERKLP…IDLRH → GKPGLAREQGCARASFLPCP SPESPVQKGE in isoform 2. 1 PublicationVSP_016939Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M29277 mRNA. Translation: AAA20824.1.
M28882 mRNA. Translation: AAA20922.1.
X68264
, X68265, X68266, X68267, X68268, X68270, X68271 Genomic DNA. Translation: CAA48332.1.
AF089868 mRNA. Translation: AAD17799.1.
AK126303 mRNA. Translation: BAC86520.1.
AB209925 mRNA. Translation: BAD93162.1. Different initiation.
BC056418 mRNA. Translation: AAH56418.1.
CCDSiCCDS31690.1. [P43121-1]
PIRiI38049.
RefSeqiNP_006491.2. NM_006500.2. [P43121-1]
UniGeneiHs.599039.

Genome annotation databases

EnsembliENST00000264036; ENSP00000264036; ENSG00000076706. [P43121-1]
GeneIDi4162.
KEGGihsa:4162.
UCSCiuc001pwf.3. human. [P43121-1]

Polymorphism databases

DMDMi85681878.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M29277 mRNA. Translation: AAA20824.1 .
M28882 mRNA. Translation: AAA20922.1 .
X68264
, X68265 , X68266 , X68267 , X68268 , X68270 , X68271 Genomic DNA. Translation: CAA48332.1 .
AF089868 mRNA. Translation: AAD17799.1 .
AK126303 mRNA. Translation: BAC86520.1 .
AB209925 mRNA. Translation: BAD93162.1 . Different initiation.
BC056418 mRNA. Translation: AAH56418.1 .
CCDSi CCDS31690.1. [P43121-1 ]
PIRi I38049.
RefSeqi NP_006491.2. NM_006500.2. [P43121-1 ]
UniGenei Hs.599039.

3D structure databases

ProteinModelPortali P43121.
SMRi P43121. Positions 27-510.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110332. 12 interactions.
DIPi DIP-52791N.
IntActi P43121. 3 interactions.
MINTi MINT-1184800.
STRINGi 9606.ENSP00000264036.

PTM databases

PhosphoSitei P43121.

Polymorphism databases

DMDMi 85681878.

Proteomic databases

MaxQBi P43121.
PaxDbi P43121.
PeptideAtlasi P43121.
PRIDEi P43121.

Protocols and materials databases

DNASUi 4162.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000264036 ; ENSP00000264036 ; ENSG00000076706 . [P43121-1 ]
GeneIDi 4162.
KEGGi hsa:4162.
UCSCi uc001pwf.3. human. [P43121-1 ]

Organism-specific databases

CTDi 4162.
GeneCardsi GC11M119179.
HGNCi HGNC:6934. MCAM.
HPAi CAB002147.
HPA008848.
MIMi 155735. gene.
neXtProti NX_P43121.
PharmGKBi PA30678.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG116686.
GeneTreei ENSGT00530000063457.
HOGENOMi HOG000015427.
HOVERGENi HBG002808.
InParanoidi P43121.
KOi K06534.
OMAi DQGEKYI.
OrthoDBi EOG7RFTH4.
PhylomeDBi P43121.
TreeFami TF330534.

Miscellaneous databases

ChiTaRSi MCAM. human.
GeneWikii CD146.
GenomeRNAii 4162.
NextBioi 16398.
PROi P43121.
SOURCEi Search...

Gene expression databases

Bgeei P43121.
CleanExi HS_MCAM.
Genevestigatori P43121.

Family and domain databases

Gene3Di 2.60.40.10. 5 hits.
InterProi IPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
IPR013151. Immunoglobulin.
[Graphical view ]
Pfami PF08205. C2-set_2. 1 hit.
PF00047. ig. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 1 hit.
SM00408. IGc2. 2 hits.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 5 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "MUC18, a marker of tumor progression in human melanoma, shows sequence similarity to the neural cell adhesion molecules of the immunoglobulin superfamily."
    Lehmann J.M., Riethmueller G., Johnson J.P.
    Proc. Natl. Acad. Sci. U.S.A. 86:9891-9895(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Melanoma.
  2. "Genomic organization of the melanoma-associated glycoprotein MUC18: implications for the evolution of the immunoglobulin domains."
    Sers C., Kirsch K., Rothbaecher U., Riethmueller G., Johnson J.P.
    Proc. Natl. Acad. Sci. U.S.A. 90:8514-8518(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), SEQUENCE REVISION.
    Tissue: Melanoma.
  3. "Identification and functional assessment of endothelial P1H12."
    Solovey A.N., Gui L., Chang L., Enenstein J., Browne P.V., Hebbel R.P.
    J. Lab. Clin. Med. 138:322-331(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Trachea.
  5. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-89.
    Tissue: Aortic endothelium.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: PNS.
  7. "Isolation and functional characterization of the A32 melanoma-associated antigen."
    Shih I.-M., Eleder D.E., Speicher D., Johnson J.P., Herlyn M.
    Cancer Res. 54:2514-2520(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 24-44; 98-112; 135-153; 240-260; 379-389 AND 460-478.
  8. Cited for: PROTEIN SEQUENCE OF 27-40; 98-112 AND 236-260.
  9. "The progression associated antigen MUC18: a unique member of the immunoglobulin supergene family."
    Johnson J.P., Rothbacher U., Sers C.
    Melanoma Res. 3:337-340(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  10. "Outside-in signaling pathway linked to CD146 engagement in human endothelial cells."
    Anfosso F., Bardin N., Vivier E., Sabatier F., Sampol J., Dignat-George F.
    J. Biol. Chem. 276:1564-1569(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-614, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-467.
    Tissue: Liver.
  13. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-614 AND SER-628, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiMUC18_HUMAN
AccessioniPrimary (citable) accession number: P43121
Secondary accession number(s): O95812
, Q59E86, Q6PHR3, Q6ZTR2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: January 10, 2006
Last modified: October 29, 2014
This is version 136 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3