Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostaglandin E2 receptor EP3 subtype

Gene

PTGER3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems (By similarity).By similarity

GO - Molecular functioni

  • prostaglandin E receptor activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:ENSG00000050628-MONOMER.
ReactomeiR-HSA-391908. Prostanoid ligand receptors.
R-HSA-418594. G alpha (i) signalling events.
SIGNORiP43115.

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin E2 receptor EP3 subtype
Short name:
PGE receptor EP3 subtype
Short name:
PGE2 receptor EP3 subtype
Alternative name(s):
PGE2-R
Prostanoid EP3 receptor
Gene namesi
Name:PTGER3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:9595. PTGER3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 53ExtracellularSequence analysisAdd BLAST53
Transmembranei54 – 78Helical; Name=1Sequence analysisAdd BLAST25
Topological domaini79 – 91CytoplasmicSequence analysisAdd BLAST13
Transmembranei92 – 112Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini113 – 131ExtracellularSequence analysisAdd BLAST19
Transmembranei132 – 153Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini154 – 175CytoplasmicSequence analysisAdd BLAST22
Transmembranei176 – 197Helical; Name=4Sequence analysisAdd BLAST22
Topological domaini198 – 227ExtracellularSequence analysisAdd BLAST30
Transmembranei228 – 253Helical; Name=5Sequence analysisAdd BLAST26
Topological domaini254 – 283CytoplasmicSequence analysisAdd BLAST30
Transmembranei284 – 307Helical; Name=6Sequence analysisAdd BLAST24
Topological domaini308 – 327ExtracellularSequence analysisAdd BLAST20
Transmembranei328 – 349Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini350 – 390CytoplasmicSequence analysisAdd BLAST41

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB
  • integral component of plasma membrane Source: ProtInc
  • nuclear envelope Source: ProtInc
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi5733.
OpenTargetsiENSG00000050628.
PharmGKBiPA288.

Chemistry databases

ChEMBLiCHEMBL3710.
DrugBankiDB00905. Bimatoprost.
DB00917. Dinoprostone.
DB00929. Misoprostol.
GuidetoPHARMACOLOGYi342.

Polymorphism and mutation databases

BioMutaiPTGER3.
DMDMi1172071.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000700581 – 390Prostaglandin E2 receptor EP3 subtypeAdd BLAST390

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi18N-linked (GlcNAc...)Sequence analysis1
Glycosylationi36N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP43115.
PeptideAtlasiP43115.
PRIDEiP43115.

PTM databases

iPTMnetiP43115.
PhosphoSitePlusiP43115.

Expressioni

Tissue specificityi

Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels.1 Publication

Gene expression databases

BgeeiENSG00000050628.
CleanExiHS_PTGER3.
ExpressionAtlasiP43115. baseline and differential.
GenevisibleiP43115. HS.

Organism-specific databases

HPAiHPA010689.

Interactioni

Protein-protein interaction databases

BioGridi111705. 112 interactors.
STRINGi9606.ENSP00000349003.

Chemistry databases

BindingDBiP43115.

Structurei

3D structure databases

ProteinModelPortaliP43115.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000119188.
HOGENOMiHOG000015238.
HOVERGENiHBG052720.
InParanoidiP43115.
KOiK04260.
OMAiFPITMLI.
OrthoDBiEOG091G09H9.
PhylomeDBiP43115.
TreeFamiTF324982.

Family and domain databases

InterProiIPR001481. EP3_rcpt_2.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view]
PANTHERiPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00584. PRSTNOIDE32R.
PR00582. PRSTNOIDEP3R.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (11)i

Sequence statusi: Complete.

This entry describes 11 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform EP3A (identifier: P43115-1) [UniParc]FASTAAdd to basket
Also known as: EP3-I, EP3a1, EP3a2, EP(3-Ic)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKETRGYGGD APFCTRLNHS YTGMWAPERS AEARGNLTRP PGSGEDCGSV
60 70 80 90 100
SVAFPITMLL TGFVGNALAM LLVSRSYRRR ESKRKKSFLL CIGWLALTDL
110 120 130 140 150
VGQLLTTPVV IVVYLSKQRW EHIDPSGRLC TFFGLTMTVF GLSSLFIASA
160 170 180 190 200
MAVERALAIR APHWYASHMK TRATRAVLLG VWLAVLAFAL LPVLGVGQYT
210 220 230 240 250
VQWPGTWCFI STGRGGNGTS SSHNWGNLFF ASAFAFLGLL ALTVTFSCNL
260 270 280 290 300
ATIKALVSRC RAKATASQSS AQWGRITTET AIQLMGIMCV LSVCWSPLLI
310 320 330 340 350
MMLKMIFNQT SVEHCKTHTE KQKECNFFLI AVRLASLNQI LDPWVYLLLR
360 370 380 390
KILLRKFCQI RYHTNNYASS STSLPCQCSS TLMWSDHLER
Length:390
Mass (Da):43,310
Last modified:November 1, 1995 - v1
Checksum:iBC76EAC78FDF5420
GO
Isoform EP3C (identifier: P43115-2) [UniParc]FASTAAdd to basket
Also known as: EP3-II

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEA

Note: Known as EP3D in PubMed:8075855.
Show »
Length:388
Mass (Da):42,682
Checksum:i96ED050A946BDC5F
GO
Isoform EP3B (identifier: P43115-3) [UniParc]FASTAAdd to basket
Also known as: EP3-III

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → EEFWGN

Note: Known as EP3E in PubMed:8075855.
Show »
Length:365
Mass (Da):40,502
Checksum:i1AA2E95EB596EB46
GO
Isoform EP3D (identifier: P43115-4) [UniParc]FASTAAdd to basket
Also known as: EP3-IV

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQEEFWGN

Note: Known as EP3F in PubMed:8075855.
Show »
Length:374
Mass (Da):41,756
Checksum:i431BF492DBA231DE
GO
Isoform EP3E (identifier: P43115-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQL...YTRISTVKTE

Show »
Length:418
Mass (Da):46,687
Checksum:i9FAA12E0E24405D3
GO
Isoform EP3F (identifier: P43115-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQA...LREPCSVQLS

Show »
Length:425
Mass (Da):47,332
Checksum:i65447F57530539F8
GO
Isoform EP3G (identifier: P43115-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → EMGPDGRCFCHAWRQVPRTWCSSHDREPCSVQLS

Show »
Length:393
Mass (Da):43,683
Checksum:i3E9981F9C4389606
GO
Isoform EP3-III (identifier: P43115-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEAEEFWGN

Show »
Length:394
Mass (Da):43,445
Checksum:i633646EC3F2576ED
GO
Isoform EP3-IV (identifier: P43115-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEAMRKRRLREQEEFWGN

Show »
Length:403
Mass (Da):44,699
Checksum:i599101B5BD1426C7
GO
Isoform EP3-V (identifier: P43115-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSN...DREPCSVQLS

Show »
Length:431
Mass (Da):47,881
Checksum:i10C8E00EB53C1CEB
GO
Isoform EP3E2 (identifier: P43115-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSN...IVGKYKPIVC

Show »
Length:422
Mass (Da):46,849
Checksum:i0EAD22290C4C2B22
GO

Sequence cautioni

The sequence CAA58742 differs from that shown. Reason: Frameshift at position 374.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti28 – 29ER → DG (PubMed:8117308).Curated2
Sequence conflicti28 – 29ER → DG (PubMed:8135729).Curated2
Sequence conflicti28 – 29ER → DG (PubMed:8075855).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_014694169M → L.Corresponds to variant rs5670dbSNPEnsembl.1
Natural variantiVAR_049436319T → M.Corresponds to variant rs13306020dbSNPEnsembl.1
Natural variantiVAR_029218366N → S.Corresponds to variant rs13306014dbSNPEnsembl.1
Natural variantiVAR_014695375P → L.Corresponds to variant rs5694dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_053774360 – 390IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAEEFWGN in isoform EP3-III. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_053775360 – 390IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQEE FWGN in isoform EP3-IV. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_053776360 – 390IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQEM GPDGRCFCHAWRQVPRTWCS SHDREPCSVQLS in isoform EP3-V. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_001936360 – 390IRYHT…DHLER → EEFWGN in isoform EP3B. 7 PublicationsAdd BLAST31
Alternative sequenceiVSP_001935360 – 390IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEA in isoform EP3C. 6 PublicationsAdd BLAST31
Alternative sequenceiVSP_001937360 – 390IRYHT…DHLER → MRKRRLREQEEFWGN in isoform EP3D. 6 PublicationsAdd BLAST31
Alternative sequenceiVSP_001938360 – 390IRYHT…DHLER → MRKRRLREQLICSLQNSQIQ RATAHCGQVQTYRVLNREEM EVLVSSINVYTRISTVKTE in isoform EP3E. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_053777360 – 390IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQLI CSLRTLRYRGQLHIVGKYKP IVC in isoform EP3E2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_001939360 – 390IRYHT…DHLER → MRKRRLREQAPLLPTPTVID PSRFCAQPFRWFLDLSFPAM SSSHPQLPLTLASFKLLREP CSVQLS in isoform EP3F. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_013271360 – 390IRYHT…DHLER → EMGPDGRCFCHAWRQVPRTW CSSHDREPCSVQLS in isoform EP3G. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S69200 mRNA. Translation: AAB29854.1.
L27488 mRNA. Translation: AAC13372.1.
L27489 mRNA. Translation: AAC13373.1.
L27490 mRNA. Translation: AAC13374.1.
X83857 mRNA. Translation: CAA58737.1.
X83858 mRNA. Translation: CAA58738.1.
X83859 mRNA. Translation: CAA58739.1.
X83860 mRNA. Translation: CAA58740.1.
X83861 mRNA. Translation: CAA58741.1.
X83862 mRNA. Translation: CAA58742.1. Frameshift.
X83863 mRNA. Translation: CAA58743.1.
L26976 mRNA. Translation: AAA60076.1.
S69326 mRNA. Translation: AAB30208.1.
L32660 mRNA. Translation: AAA68191.1.
L32661 mRNA. Translation: AAA68192.1.
L32662 mRNA. Translation: AAA68193.1.
D38297 mRNA. Translation: BAA07416.1.
D38298 mRNA. Translation: BAA07417.1.
D38299 mRNA. Translation: BAA07418.1.
D38300 mRNA. Translation: BAA07419.1.
D38301 mRNA. Translation: BAA07420.1.
U13214 mRNA. Translation: AAA21130.1.
U13215 mRNA. Translation: AAA21131.1.
U13216 mRNA. Translation: AAA21132.1.
U13217 mRNA. Translation: AAA21133.1.
U13218 mRNA. Translation: AAA21134.1.
D86096 Genomic DNA. Translation: BAA19951.1.
D86096 Genomic DNA. Translation: BAA19952.1.
D86096 Genomic DNA. Translation: BAA19953.1.
D86096 Genomic DNA. Translation: BAA19954.1.
D86096 Genomic DNA. Translation: BAA19956.1.
D86096 Genomic DNA. Translation: BAA19957.1.
D86098 mRNA. Translation: BAA19959.1.
AY429108 mRNA. Translation: AAR07903.1.
AK315825 mRNA. Translation: BAF98716.1.
AB451481 mRNA. Translation: BAG70295.1.
AL031429 Genomic DNA. Translation: CAI20226.1.
AL031429 Genomic DNA. Translation: CAI20227.1.
AL031429, AL158087 Genomic DNA. Translation: CAI20228.1.
AL158087, AL031429 Genomic DNA. Translation: CAI23437.1.
AL031429 Genomic DNA. Translation: CAB52459.1.
CH471059 Genomic DNA. Translation: EAX06439.1.
CH471059 Genomic DNA. Translation: EAX06446.1.
BC024229 mRNA. Translation: AAH24229.1.
CCDSiCCDS44160.1. [P43115-3]
CCDS652.1. [P43115-4]
CCDS655.1. [P43115-5]
CCDS656.1. [P43115-1]
CCDS657.1. [P43115-1]
CCDS658.1. [P43115-2]
PIRiB55995.
I38747.
I38748.
I38750.
JC2056.
S43375.
S68994. S51313.
S68995. S51315.
S68996. S51316.
S68997. S51317.
S68998. S51318.
S68999. S51319.
RefSeqiNP_001119516.1. NM_001126044.1. [P43115-1]
NP_942007.1. NM_198714.1. [P43115-1]
NP_942008.1. NM_198715.2. [P43115-2]
NP_942009.1. NM_198716.1. [P43115-4]
NP_942010.1. NM_198717.1. [P43115-3]
NP_942011.1. NM_198718.1. [P43115-5]
NP_942012.1. NM_198719.1. [P43115-1]
UniGeneiHs.445000.

Genome annotation databases

EnsembliENST00000306666; ENSP00000302313; ENSG00000050628. [P43115-1]
ENST00000351052; ENSP00000280208; ENSG00000050628. [P43115-1]
ENST00000356595; ENSP00000349003; ENSG00000050628. [P43115-5]
ENST00000370924; ENSP00000359962; ENSG00000050628. [P43115-2]
ENST00000370931; ENSP00000359969; ENSG00000050628. [P43115-1]
ENST00000460330; ENSP00000418073; ENSG00000050628. [P43115-4]
ENST00000479353; ENSP00000421583; ENSG00000050628. [P43115-7]
ENST00000628037; ENSP00000486617; ENSG00000050628. [P43115-3]
GeneIDi5733.
KEGGihsa:5733.
UCSCiuc001dfg.2. human. [P43115-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S69200 mRNA. Translation: AAB29854.1.
L27488 mRNA. Translation: AAC13372.1.
L27489 mRNA. Translation: AAC13373.1.
L27490 mRNA. Translation: AAC13374.1.
X83857 mRNA. Translation: CAA58737.1.
X83858 mRNA. Translation: CAA58738.1.
X83859 mRNA. Translation: CAA58739.1.
X83860 mRNA. Translation: CAA58740.1.
X83861 mRNA. Translation: CAA58741.1.
X83862 mRNA. Translation: CAA58742.1. Frameshift.
X83863 mRNA. Translation: CAA58743.1.
L26976 mRNA. Translation: AAA60076.1.
S69326 mRNA. Translation: AAB30208.1.
L32660 mRNA. Translation: AAA68191.1.
L32661 mRNA. Translation: AAA68192.1.
L32662 mRNA. Translation: AAA68193.1.
D38297 mRNA. Translation: BAA07416.1.
D38298 mRNA. Translation: BAA07417.1.
D38299 mRNA. Translation: BAA07418.1.
D38300 mRNA. Translation: BAA07419.1.
D38301 mRNA. Translation: BAA07420.1.
U13214 mRNA. Translation: AAA21130.1.
U13215 mRNA. Translation: AAA21131.1.
U13216 mRNA. Translation: AAA21132.1.
U13217 mRNA. Translation: AAA21133.1.
U13218 mRNA. Translation: AAA21134.1.
D86096 Genomic DNA. Translation: BAA19951.1.
D86096 Genomic DNA. Translation: BAA19952.1.
D86096 Genomic DNA. Translation: BAA19953.1.
D86096 Genomic DNA. Translation: BAA19954.1.
D86096 Genomic DNA. Translation: BAA19956.1.
D86096 Genomic DNA. Translation: BAA19957.1.
D86098 mRNA. Translation: BAA19959.1.
AY429108 mRNA. Translation: AAR07903.1.
AK315825 mRNA. Translation: BAF98716.1.
AB451481 mRNA. Translation: BAG70295.1.
AL031429 Genomic DNA. Translation: CAI20226.1.
AL031429 Genomic DNA. Translation: CAI20227.1.
AL031429, AL158087 Genomic DNA. Translation: CAI20228.1.
AL158087, AL031429 Genomic DNA. Translation: CAI23437.1.
AL031429 Genomic DNA. Translation: CAB52459.1.
CH471059 Genomic DNA. Translation: EAX06439.1.
CH471059 Genomic DNA. Translation: EAX06446.1.
BC024229 mRNA. Translation: AAH24229.1.
CCDSiCCDS44160.1. [P43115-3]
CCDS652.1. [P43115-4]
CCDS655.1. [P43115-5]
CCDS656.1. [P43115-1]
CCDS657.1. [P43115-1]
CCDS658.1. [P43115-2]
PIRiB55995.
I38747.
I38748.
I38750.
JC2056.
S43375.
S68994. S51313.
S68995. S51315.
S68996. S51316.
S68997. S51317.
S68998. S51318.
S68999. S51319.
RefSeqiNP_001119516.1. NM_001126044.1. [P43115-1]
NP_942007.1. NM_198714.1. [P43115-1]
NP_942008.1. NM_198715.2. [P43115-2]
NP_942009.1. NM_198716.1. [P43115-4]
NP_942010.1. NM_198717.1. [P43115-3]
NP_942011.1. NM_198718.1. [P43115-5]
NP_942012.1. NM_198719.1. [P43115-1]
UniGeneiHs.445000.

3D structure databases

ProteinModelPortaliP43115.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111705. 112 interactors.
STRINGi9606.ENSP00000349003.

Chemistry databases

BindingDBiP43115.
ChEMBLiCHEMBL3710.
DrugBankiDB00905. Bimatoprost.
DB00917. Dinoprostone.
DB00929. Misoprostol.
GuidetoPHARMACOLOGYi342.

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiP43115.
PhosphoSitePlusiP43115.

Polymorphism and mutation databases

BioMutaiPTGER3.
DMDMi1172071.

Proteomic databases

PaxDbiP43115.
PeptideAtlasiP43115.
PRIDEiP43115.

Protocols and materials databases

DNASUi5733.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306666; ENSP00000302313; ENSG00000050628. [P43115-1]
ENST00000351052; ENSP00000280208; ENSG00000050628. [P43115-1]
ENST00000356595; ENSP00000349003; ENSG00000050628. [P43115-5]
ENST00000370924; ENSP00000359962; ENSG00000050628. [P43115-2]
ENST00000370931; ENSP00000359969; ENSG00000050628. [P43115-1]
ENST00000460330; ENSP00000418073; ENSG00000050628. [P43115-4]
ENST00000479353; ENSP00000421583; ENSG00000050628. [P43115-7]
ENST00000628037; ENSP00000486617; ENSG00000050628. [P43115-3]
GeneIDi5733.
KEGGihsa:5733.
UCSCiuc001dfg.2. human. [P43115-1]

Organism-specific databases

CTDi5733.
DisGeNETi5733.
GeneCardsiPTGER3.
H-InvDBHIX0029392.
HGNCiHGNC:9595. PTGER3.
HPAiHPA010689.
MIMi176806. gene.
neXtProtiNX_P43115.
OpenTargetsiENSG00000050628.
PharmGKBiPA288.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000119188.
HOGENOMiHOG000015238.
HOVERGENiHBG052720.
InParanoidiP43115.
KOiK04260.
OMAiFPITMLI.
OrthoDBiEOG091G09H9.
PhylomeDBiP43115.
TreeFamiTF324982.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000050628-MONOMER.
ReactomeiR-HSA-391908. Prostanoid ligand receptors.
R-HSA-418594. G alpha (i) signalling events.
SIGNORiP43115.

Miscellaneous databases

ChiTaRSiPTGER3. human.
GenomeRNAii5733.
PROiP43115.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000050628.
CleanExiHS_PTGER3.
ExpressionAtlasiP43115. baseline and differential.
GenevisibleiP43115. HS.

Family and domain databases

InterProiIPR001481. EP3_rcpt_2.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view]
PANTHERiPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00584. PRSTNOIDE32R.
PR00582. PRSTNOIDEP3R.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPE2R3_HUMAN
AccessioniPrimary (citable) accession number: P43115
Secondary accession number(s): B0AZN4
, B1AK19, B5BUP5, O00326, Q12943, Q12944, Q12945, Q16546, Q5CZ59, Q5CZ61, Q5CZ62, Q5CZ63, Q5CZ64
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: November 2, 2016
This is version 169 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.