Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P43115 (PE2R3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 145. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Prostaglandin E2 receptor EP3 subtype

Short name=PGE receptor EP3 subtype
Short name=PGE2 receptor EP3 subtype
Alternative name(s):
PGE2-R
Prostanoid EP3 receptor
Gene names
Name:PTGER3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length390 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems By similarity.

Subcellular location

Cell membrane; Multi-pass membrane protein.

Tissue specificity

Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels. Ref.15

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Alternative products

This entry describes 11 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform EP3A (identifier: P43115-1)

Also known as: EP3-I; EP3a1; EP3a2; EP(3-Ic);

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform EP3C (identifier: P43115-2)

Also known as: EP3-II;

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEA
Note: Known as EP3D in PubMed:8075855.
Isoform EP3B (identifier: P43115-3)

Also known as: EP3-III;

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → EEFWGN
Note: Known as EP3E in PubMed:8075855.
Isoform EP3D (identifier: P43115-4)

Also known as: EP3-IV;

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQEEFWGN
Note: Known as EP3F in PubMed:8075855.
Isoform EP3E (identifier: P43115-5)

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQLICSLRTLRYRGQLHIVGKYKPIVC
Isoform EP3F (identifier: P43115-6)

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQA...LREPCSVQLS
Isoform EP3G (identifier: P43115-7)

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → EMGPDGRCFCHAWRQVPRTWCSSHDREPCSVQLS
Isoform EP3-III (identifier: P43115-8)

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEAEEFWGN
Isoform EP3-IV (identifier: P43115-9)

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEAMRKRRLREQEEFWGN
Isoform EP3-V (identifier: P43115-10)

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSN...DREPCSVQLS
Isoform EP3E2 (identifier: P43115-11)

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSN...IVGKYKPIVC

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 390390Prostaglandin E2 receptor EP3 subtype
PRO_0000070058

Regions

Topological domain1 – 5353Extracellular Potential
Transmembrane54 – 7825Helical; Name=1; Potential
Topological domain79 – 9113Cytoplasmic Potential
Transmembrane92 – 11221Helical; Name=2; Potential
Topological domain113 – 13119Extracellular Potential
Transmembrane132 – 15322Helical; Name=3; Potential
Topological domain154 – 17522Cytoplasmic Potential
Transmembrane176 – 19722Helical; Name=4; Potential
Topological domain198 – 22730Extracellular Potential
Transmembrane228 – 25326Helical; Name=5; Potential
Topological domain254 – 28330Cytoplasmic Potential
Transmembrane284 – 30724Helical; Name=6; Potential
Topological domain308 – 32720Extracellular Potential
Transmembrane328 – 34922Helical; Name=7; Potential
Topological domain350 – 39041Cytoplasmic Potential

Amino acid modifications

Glycosylation181N-linked (GlcNAc...) Potential
Glycosylation361N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAEEFWGN in isoform EP3-III.
VSP_053774
Alternative sequence360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQEE FWGN in isoform EP3-IV.
VSP_053775
Alternative sequence360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQEM GPDGRCFCHAWRQVPRTWCS SHDREPCSVQLS in isoform EP3-V.
VSP_053776
Alternative sequence360 – 39031IRYHT…DHLER → EEFWGN in isoform EP3B.
VSP_001936
Alternative sequence360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEA in isoform EP3C.
VSP_001935
Alternative sequence360 – 39031IRYHT…DHLER → MRKRRLREQEEFWGN in isoform EP3D.
VSP_001937
Alternative sequence360 – 39031IRYHT…DHLER → MRKRRLREQLICSLRTLRYR GQLHIVGKYKPIVC in isoform EP3E.
VSP_001938
Alternative sequence360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQLI CSLRTLRYRGQLHIVGKYKP IVC in isoform EP3E2.
VSP_053777
Alternative sequence360 – 39031IRYHT…DHLER → MRKRRLREQAPLLPTPTVID PSRFCAQPFRWFLDLSFPAM SSSHPQLPLTLASFKLLREP CSVQLS in isoform EP3F.
VSP_001939
Alternative sequence360 – 39031IRYHT…DHLER → EMGPDGRCFCHAWRQVPRTW CSSHDREPCSVQLS in isoform EP3G.
VSP_013271
Natural variant1691M → L.
Corresponds to variant rs5670 [ dbSNP | Ensembl ].
VAR_014694
Natural variant3191T → M.
Corresponds to variant rs13306020 [ dbSNP | Ensembl ].
VAR_049436
Natural variant3661N → S.
Corresponds to variant rs13306014 [ dbSNP | Ensembl ].
VAR_029218
Natural variant3751P → L.
Corresponds to variant rs5694 [ dbSNP | Ensembl ].
VAR_014695

Experimental info

Sequence conflict28 – 292ER → DG Ref.3
Sequence conflict28 – 292ER → DG Ref.4
Sequence conflict28 – 292ER → DG Ref.7

Sequences

Sequence LengthMass (Da)Tools
Isoform EP3A (EP3-I) (EP3a1) (EP3a2) (EP(3-Ic)) [UniParc].

Last modified November 1, 1995. Version 1.
Checksum: BC76EAC78FDF5420

FASTA39043,310
        10         20         30         40         50         60 
MKETRGYGGD APFCTRLNHS YTGMWAPERS AEARGNLTRP PGSGEDCGSV SVAFPITMLL 

        70         80         90        100        110        120 
TGFVGNALAM LLVSRSYRRR ESKRKKSFLL CIGWLALTDL VGQLLTTPVV IVVYLSKQRW 

       130        140        150        160        170        180 
EHIDPSGRLC TFFGLTMTVF GLSSLFIASA MAVERALAIR APHWYASHMK TRATRAVLLG 

       190        200        210        220        230        240 
VWLAVLAFAL LPVLGVGQYT VQWPGTWCFI STGRGGNGTS SSHNWGNLFF ASAFAFLGLL 

       250        260        270        280        290        300 
ALTVTFSCNL ATIKALVSRC RAKATASQSS AQWGRITTET AIQLMGIMCV LSVCWSPLLI 

       310        320        330        340        350        360 
MMLKMIFNQT SVEHCKTHTE KQKECNFFLI AVRLASLNQI LDPWVYLLLR KILLRKFCQI 

       370        380        390 
RYHTNNYASS STSLPCQCSS TLMWSDHLER 

« Hide

Isoform EP3C (EP3-II) [UniParc].

Checksum: 96ED050A946BDC5F
Show »

FASTA38842,682
Isoform EP3B (EP3-III) [UniParc].

Checksum: 1AA2E95EB596EB46
Show »

FASTA36540,502
Isoform EP3D (EP3-IV) [UniParc].

Checksum: 431BF492DBA231DE
Show »

FASTA37441,756
Isoform EP3E [UniParc].

Checksum: 882FA7D2A4A56427
Show »

FASTA39343,906
Isoform EP3F [UniParc].

Checksum: 65447F57530539F8
Show »

FASTA42547,332
Isoform EP3G [UniParc].

Checksum: 3E9981F9C4389606
Show »

FASTA39343,683
Isoform EP3-III [UniParc].

Checksum: 633646EC3F2576ED
Show »

FASTA39443,445
Isoform EP3-IV [UniParc].

Checksum: 599101B5BD1426C7
Show »

FASTA40344,699
Isoform EP3-V [UniParc].

Checksum: 10C8E00EB53C1CEB
Show »

FASTA43147,881
Isoform EP3E2 [UniParc].

Checksum: 0EAD22290C4C2B22
Show »

FASTA42246,849

References

« Hide 'large scale' references
[1]"Cloning and expression of three isoforms of the human EP3 prostanoid receptor."
Adam M., Boie Y., Rushmore T.H., Mueller G., Bastien L., McKee K.T., Metters K.M., Abramovitz M.
FEBS Lett. 338:170-174(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B AND EP3C).
[2]"Splice variants of the human EP3 receptor for prostaglandin E2."
Schmid A., Thierauch K.H., Schleuning W.-D., Dinter H.
Eur. J. Biochem. 228:23-30(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B; EP3C; EP3D; EP3E AND EP3F).
Tissue: Uterus.
[3]"Cloning and expression of the EP3-subtype of human receptors for prostaglandin E2."
Yang J., Xia M., Goetzl E.J., An S.
Biochem. Biophys. Res. Commun. 198:999-1006(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EP3A).
Tissue: Kidney.
[4]"Cloning and expression of a prostaglandin E receptor EP3 subtype from human erythroleukaemia cells."
Kunapuli S.P., Fen Mao G., Bastepe M., Liu-Chen L.-Y., Li S., Cheung P.P., DeRiel J.K., Ashby B.
Biochem. J. 298:263-267(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EP3A).
[5]"Isoforms of the EP3 subtype of human prostaglandin E2 receptor transduce both intracellular calcium and cAMP signals."
An S., Yang J., So S.W., Zeng L., Goetzl E.J.
Biochemistry 33:14496-14502(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3B; EP3C AND EP3D).
Tissue: Uterus.
[6]"Molecular cloning and expression of multiple isoforms of human prostaglandin E receptor EP3 subtype generated by alternative messenger RNA splicing: multiple second messenger systems and tissue-specific distributions."
Kotani M., Tanaka I., Ogawa Y., Usui T., Mori K., Ichikawa A., Narumiya S., Yoshimi T., Nakao K.
Mol. Pharmacol. 48:869-879(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B; EP3C AND EP3D).
Tissue: Kidney.
[7]"Molecular cloning and expression of human EP3 receptors: evidence of three variants with differing carboxyl termini."
Regan J.W., Bailey T.J., Donello J.E., Pierce K.L., Pepperl D.J., Zhang D., Kedzie K.M., Fairbairn C.E., Bogardus A.M., Woodward D.F., Gil D.W.
Br. J. Pharmacol. 112:377-385(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B; EP3C AND EP3D).
Tissue: Small intestine.
[8]"Structural organization of the human prostaglandin EP3 receptor subtype gene (PTGER3)."
Kotani M., Tanaka I., Ogawa Y., Usui T., Tamura N., Mori K., Narumiya S., Yoshimi T., Nakao K.
Genomics 40:425-434(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS EP3C; EP3E; EP3-III; EP3-IV; EP3-V AND EP3E2), ALTERNATIVE SPLICING.
[9]"cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
Kopatz S.A., Aronstam R.S., Sharma S.V.
Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3G).
Tissue: Placenta.
[10]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3A).
[11]"Human protein factory for converting the transcriptome into an in vitro-expressed proteome."
Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. expand/collapse author list , Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.
Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3B).
[12]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[13]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[14]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3D).
Tissue: Lung.
[15]"A new mRNA splice variant coding for the human EP3-I receptor isoform."
Kotelevets L., Foudi N., Louedec L., Couvelard A., Chastre E., Norel X.
Prostaglandins Leukot. Essent. Fatty Acids 77:195-201(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
S69200 mRNA. Translation: AAB29854.1.
L27488 mRNA. Translation: AAC13372.1.
L27489 mRNA. Translation: AAC13373.1.
L27490 mRNA. Translation: AAC13374.1.
X83857 mRNA. Translation: CAA58737.1.
X83858 mRNA. Translation: CAA58738.1.
X83859 mRNA. Translation: CAA58739.1.
X83860 mRNA. Translation: CAA58740.1.
X83861 mRNA. Translation: CAA58741.1.
X83862 mRNA. Translation: CAA58742.1.
X83863 mRNA. Translation: CAA58743.1.
L26976 mRNA. Translation: AAA60076.1.
S69326 mRNA. Translation: AAB30208.1.
L32660 mRNA. Translation: AAA68191.1.
L32661 mRNA. Translation: AAA68192.1.
L32662 mRNA. Translation: AAA68193.1.
D38297 mRNA. Translation: BAA07416.1.
D38298 mRNA. Translation: BAA07417.1.
D38299 mRNA. Translation: BAA07418.1.
D38300 mRNA. Translation: BAA07419.1.
D38301 mRNA. Translation: BAA07420.1.
U13214 mRNA. Translation: AAA21130.1.
U13215 mRNA. Translation: AAA21131.1.
U13216 mRNA. Translation: AAA21132.1.
U13217 mRNA. Translation: AAA21133.1.
U13218 mRNA. Translation: AAA21134.1.
D86096 Genomic DNA. Translation: BAA19951.1.
D86096 Genomic DNA. Translation: BAA19952.1.
D86096 Genomic DNA. Translation: BAA19954.1.
D86096 Genomic DNA. Translation: BAA19956.1.
D86096 Genomic DNA. Translation: BAA19957.1.
D86098 mRNA. Translation: BAA19959.1.
AY429108 mRNA. Translation: AAR07903.1.
AK315825 mRNA. Translation: BAF98716.1.
AB451481 mRNA. Translation: BAG70295.1.
AL031429 Genomic DNA. Translation: CAI20226.1.
AL031429 Genomic DNA. Translation: CAI20227.1.
AL031429, AL158087 Genomic DNA. Translation: CAI20228.1.
AL158087, AL031429 Genomic DNA. Translation: CAI23437.1.
AL031429 Genomic DNA. Translation: CAB52459.1.
CH471059 Genomic DNA. Translation: EAX06439.1.
CH471059 Genomic DNA. Translation: EAX06446.1.
BC024229 mRNA. Translation: AAH24229.1.
CCDSCCDS44160.1. [P43115-3]
CCDS652.1. [P43115-4]
CCDS656.1. [P43115-1]
CCDS657.1. [P43115-1]
CCDS658.1. [P43115-2]
PIRB55995.
I38747.
I38748.
I38750.
JC2056.
S43375.
S51313. S68994.
S51315. S68995.
S51316. S68996.
S51317. S68997.
S51318. S68998.
S51319. S68999.
RefSeqNP_001119516.1. NM_001126044.1. [P43115-1]
NP_942007.1. NM_198714.1. [P43115-1]
NP_942008.1. NM_198715.2. [P43115-2]
NP_942009.1. NM_198716.1. [P43115-4]
NP_942010.1. NM_198717.1. [P43115-3]
NP_942011.1. NM_198718.1.
NP_942012.1. NM_198719.1. [P43115-1]
UniGeneHs.445000.

3D structure databases

ProteinModelPortalP43115.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid111705. 2 interactions.
STRING9606.ENSP00000349003.

Chemistry

BindingDBP43115.
ChEMBLCHEMBL3710.
DrugBankDB00905. Bimatoprost.
GuidetoPHARMACOLOGY342.

Protein family/group databases

GPCRDBSearch...

Polymorphism databases

DMDM1172071.

Proteomic databases

PaxDbP43115.
PRIDEP43115.

Protocols and materials databases

DNASU5733.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000306666; ENSP00000302313; ENSG00000050628. [P43115-1]
ENST00000370924; ENSP00000359962; ENSG00000050628. [P43115-2]
ENST00000370931; ENSP00000359969; ENSG00000050628. [P43115-1]
ENST00000370932; ENSP00000359970; ENSG00000050628. [P43115-3]
ENST00000414819; ENSP00000401423; ENSG00000050628. [P43115-1]
ENST00000460330; ENSP00000418073; ENSG00000050628. [P43115-4]
ENST00000479353; ENSP00000421583; ENSG00000050628. [P43115-7]
GeneID5733.
KEGGhsa:5733.
UCSCuc001dfg.1. human. [P43115-1]
uc001dfk.1. human. [P43115-4]
uc001dfl.1. human. [P43115-3]
uc001dfq.3. human. [P43115-2]

Organism-specific databases

CTD5733.
GeneCardsGC01M071318.
H-InvDBHIX0029392.
HGNCHGNC:9595. PTGER3.
HPAHPA010689.
MIM176806. gene.
neXtProtNX_P43115.
PharmGKBPA288.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG244691.
HOVERGENHBG052720.
KOK04260.
OrthoDBEOG70W3D9.
PhylomeDBP43115.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

ArrayExpressP43115.
BgeeP43115.
CleanExHS_PTGER3.
GenevestigatorP43115.

Family and domain databases

Gene3D1.20.1070.10. 1 hit.
InterProIPR001481. EP3_rcpt_2.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view]
PANTHERPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
PfamPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSPR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00584. PRSTNOIDE32R.
PR00582. PRSTNOIDEP3R.
PROSITEPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi5733.
NextBio22302.
PROP43115.
SOURCESearch...

Entry information

Entry namePE2R3_HUMAN
AccessionPrimary (citable) accession number: P43115
Secondary accession number(s): B0AZN4 expand/collapse secondary AC list , B5BUP5, O00326, Q12943, Q12944, Q12945, Q16546, Q5CZ59, Q5CZ62, Q5CZ63, Q5CZ64
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: July 9, 2014
This is version 145 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries