SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P43115

- PE2R3_HUMAN

UniProt

P43115 - PE2R3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Prostaglandin E2 receptor EP3 subtype
Gene
PTGER3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems By similarity.

GO - Molecular functioni

  1. ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity Source: ProtInc
  2. prostaglandin E receptor activity Source: UniProtKB

GO - Biological processi

  1. G-protein coupled receptor signaling pathway Source: ProtInc
  2. cell death Source: ProtInc
  3. intracellular receptor signaling pathway Source: GOC
  4. positive regulation of fever generation Source: BHF-UCL
  5. transcription, DNA-templated Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiREACT_18425. Prostanoid ligand receptors.
REACT_19231. G alpha (i) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin E2 receptor EP3 subtype
Short name:
PGE receptor EP3 subtype
Short name:
PGE2 receptor EP3 subtype
Alternative name(s):
PGE2-R
Prostanoid EP3 receptor
Gene namesi
Name:PTGER3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:9595. PTGER3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 5353Extracellular Reviewed prediction
Add
BLAST
Transmembranei54 – 7825Helical; Name=1; Reviewed prediction
Add
BLAST
Topological domaini79 – 9113Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei92 – 11221Helical; Name=2; Reviewed prediction
Add
BLAST
Topological domaini113 – 13119Extracellular Reviewed prediction
Add
BLAST
Transmembranei132 – 15322Helical; Name=3; Reviewed prediction
Add
BLAST
Topological domaini154 – 17522Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei176 – 19722Helical; Name=4; Reviewed prediction
Add
BLAST
Topological domaini198 – 22730Extracellular Reviewed prediction
Add
BLAST
Transmembranei228 – 25326Helical; Name=5; Reviewed prediction
Add
BLAST
Topological domaini254 – 28330Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei284 – 30724Helical; Name=6; Reviewed prediction
Add
BLAST
Topological domaini308 – 32720Extracellular Reviewed prediction
Add
BLAST
Transmembranei328 – 34922Helical; Name=7; Reviewed prediction
Add
BLAST
Topological domaini350 – 39041Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB
  2. integral component of plasma membrane Source: ProtInc
  3. nuclear envelope Source: ProtInc
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA288.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 390390Prostaglandin E2 receptor EP3 subtype
PRO_0000070058Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi18 – 181N-linked (GlcNAc...) Reviewed prediction
Glycosylationi36 – 361N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP43115.
PRIDEiP43115.

Expressioni

Tissue specificityi

Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels.1 Publication

Gene expression databases

ArrayExpressiP43115.
BgeeiP43115.
CleanExiHS_PTGER3.
GenevestigatoriP43115.

Organism-specific databases

HPAiHPA010689.

Interactioni

Protein-protein interaction databases

BioGridi111705. 2 interactions.
STRINGi9606.ENSP00000349003.

Structurei

3D structure databases

ProteinModelPortaliP43115.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG244691.
HOVERGENiHBG052720.
KOiK04260.
OrthoDBiEOG70W3D9.
PhylomeDBiP43115.

Family and domain databases

Gene3Di1.20.1070.10. 1 hit.
InterProiIPR001481. EP3_rcpt_2.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view]
PANTHERiPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00584. PRSTNOIDE32R.
PR00582. PRSTNOIDEP3R.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (11)i

Sequence statusi: Complete.

This entry describes 11 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform EP3A (identifier: P43115-1) [UniParc]FASTAAdd to Basket

Also known as: EP3-I, EP3a1, EP3a2, EP(3-Ic)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKETRGYGGD APFCTRLNHS YTGMWAPERS AEARGNLTRP PGSGEDCGSV    50
SVAFPITMLL TGFVGNALAM LLVSRSYRRR ESKRKKSFLL CIGWLALTDL 100
VGQLLTTPVV IVVYLSKQRW EHIDPSGRLC TFFGLTMTVF GLSSLFIASA 150
MAVERALAIR APHWYASHMK TRATRAVLLG VWLAVLAFAL LPVLGVGQYT 200
VQWPGTWCFI STGRGGNGTS SSHNWGNLFF ASAFAFLGLL ALTVTFSCNL 250
ATIKALVSRC RAKATASQSS AQWGRITTET AIQLMGIMCV LSVCWSPLLI 300
MMLKMIFNQT SVEHCKTHTE KQKECNFFLI AVRLASLNQI LDPWVYLLLR 350
KILLRKFCQI RYHTNNYASS STSLPCQCSS TLMWSDHLER 390
Length:390
Mass (Da):43,310
Last modified:November 1, 1995 - v1
Checksum:iBC76EAC78FDF5420
GO
Isoform EP3C (identifier: P43115-2) [UniParc]FASTAAdd to Basket

Also known as: EP3-II

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEA

Note: Known as EP3D in PubMed:8075855.

Show »
Length:388
Mass (Da):42,682
Checksum:i96ED050A946BDC5F
GO
Isoform EP3B (identifier: P43115-3) [UniParc]FASTAAdd to Basket

Also known as: EP3-III

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → EEFWGN

Note: Known as EP3E in PubMed:8075855.

Show »
Length:365
Mass (Da):40,502
Checksum:i1AA2E95EB596EB46
GO
Isoform EP3D (identifier: P43115-4) [UniParc]FASTAAdd to Basket

Also known as: EP3-IV

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQEEFWGN

Note: Known as EP3F in PubMed:8075855.

Show »
Length:374
Mass (Da):41,756
Checksum:i431BF492DBA231DE
GO
Isoform EP3E (identifier: P43115-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQLICSLRTLRYRGQLHIVGKYKPIVC

Show »
Length:393
Mass (Da):43,906
Checksum:i882FA7D2A4A56427
GO
Isoform EP3F (identifier: P43115-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQA...LREPCSVQLS

Show »
Length:425
Mass (Da):47,332
Checksum:i65447F57530539F8
GO
Isoform EP3G (identifier: P43115-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → EMGPDGRCFCHAWRQVPRTWCSSHDREPCSVQLS

Show »
Length:393
Mass (Da):43,683
Checksum:i3E9981F9C4389606
GO
Isoform EP3-III (identifier: P43115-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEAEEFWGN

Show »
Length:394
Mass (Da):43,445
Checksum:i633646EC3F2576ED
GO
Isoform EP3-IV (identifier: P43115-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEAMRKRRLREQEEFWGN

Show »
Length:403
Mass (Da):44,699
Checksum:i599101B5BD1426C7
GO
Isoform EP3-V (identifier: P43115-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSN...DREPCSVQLS

Show »
Length:431
Mass (Da):47,881
Checksum:i10C8E00EB53C1CEB
GO
Isoform EP3E2 (identifier: P43115-11) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSN...IVGKYKPIVC

Show »
Length:422
Mass (Da):46,849
Checksum:i0EAD22290C4C2B22
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti169 – 1691M → L.
Corresponds to variant rs5670 [ dbSNP | Ensembl ].
VAR_014694
Natural varianti319 – 3191T → M.
Corresponds to variant rs13306020 [ dbSNP | Ensembl ].
VAR_049436
Natural varianti366 – 3661N → S.
Corresponds to variant rs13306014 [ dbSNP | Ensembl ].
VAR_029218
Natural varianti375 – 3751P → L.
Corresponds to variant rs5694 [ dbSNP | Ensembl ].
VAR_014695

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAEEFWGN in isoform EP3-III.
VSP_053774Add
BLAST
Alternative sequencei360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQEE FWGN in isoform EP3-IV.
VSP_053775Add
BLAST
Alternative sequencei360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQEM GPDGRCFCHAWRQVPRTWCS SHDREPCSVQLS in isoform EP3-V.
VSP_053776Add
BLAST
Alternative sequencei360 – 39031IRYHT…DHLER → EEFWGN in isoform EP3B.
VSP_001936Add
BLAST
Alternative sequencei360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEA in isoform EP3C.
VSP_001935Add
BLAST
Alternative sequencei360 – 39031IRYHT…DHLER → MRKRRLREQEEFWGN in isoform EP3D.
VSP_001937Add
BLAST
Alternative sequencei360 – 39031IRYHT…DHLER → MRKRRLREQLICSLRTLRYR GQLHIVGKYKPIVC in isoform EP3E.
VSP_001938Add
BLAST
Alternative sequencei360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQLI CSLRTLRYRGQLHIVGKYKP IVC in isoform EP3E2.
VSP_053777Add
BLAST
Alternative sequencei360 – 39031IRYHT…DHLER → MRKRRLREQAPLLPTPTVID PSRFCAQPFRWFLDLSFPAM SSSHPQLPLTLASFKLLREP CSVQLS in isoform EP3F.
VSP_001939Add
BLAST
Alternative sequencei360 – 39031IRYHT…DHLER → EMGPDGRCFCHAWRQVPRTW CSSHDREPCSVQLS in isoform EP3G.
VSP_013271Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti28 – 292ER → DG1 Publication
Sequence conflicti28 – 292ER → DG1 Publication
Sequence conflicti28 – 292ER → DG1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
S69200 mRNA. Translation: AAB29854.1.
L27488 mRNA. Translation: AAC13372.1.
L27489 mRNA. Translation: AAC13373.1.
L27490 mRNA. Translation: AAC13374.1.
X83857 mRNA. Translation: CAA58737.1.
X83858 mRNA. Translation: CAA58738.1.
X83859 mRNA. Translation: CAA58739.1.
X83860 mRNA. Translation: CAA58740.1.
X83861 mRNA. Translation: CAA58741.1.
X83862 mRNA. Translation: CAA58742.1.
X83863 mRNA. Translation: CAA58743.1.
L26976 mRNA. Translation: AAA60076.1.
S69326 mRNA. Translation: AAB30208.1.
L32660 mRNA. Translation: AAA68191.1.
L32661 mRNA. Translation: AAA68192.1.
L32662 mRNA. Translation: AAA68193.1.
D38297 mRNA. Translation: BAA07416.1.
D38298 mRNA. Translation: BAA07417.1.
D38299 mRNA. Translation: BAA07418.1.
D38300 mRNA. Translation: BAA07419.1.
D38301 mRNA. Translation: BAA07420.1.
U13214 mRNA. Translation: AAA21130.1.
U13215 mRNA. Translation: AAA21131.1.
U13216 mRNA. Translation: AAA21132.1.
U13217 mRNA. Translation: AAA21133.1.
U13218 mRNA. Translation: AAA21134.1.
D86096 Genomic DNA. Translation: BAA19951.1.
D86096 Genomic DNA. Translation: BAA19952.1.
D86096 Genomic DNA. Translation: BAA19954.1.
D86096 Genomic DNA. Translation: BAA19956.1.
D86096 Genomic DNA. Translation: BAA19957.1.
D86098 mRNA. Translation: BAA19959.1.
AY429108 mRNA. Translation: AAR07903.1.
AK315825 mRNA. Translation: BAF98716.1.
AB451481 mRNA. Translation: BAG70295.1.
AL031429 Genomic DNA. Translation: CAI20226.1.
AL031429 Genomic DNA. Translation: CAI20227.1.
AL031429, AL158087 Genomic DNA. Translation: CAI20228.1.
AL158087, AL031429 Genomic DNA. Translation: CAI23437.1.
AL031429 Genomic DNA. Translation: CAB52459.1.
CH471059 Genomic DNA. Translation: EAX06439.1.
CH471059 Genomic DNA. Translation: EAX06446.1.
BC024229 mRNA. Translation: AAH24229.1.
CCDSiCCDS44160.1. [P43115-3]
CCDS652.1. [P43115-4]
CCDS656.1. [P43115-1]
CCDS657.1. [P43115-1]
CCDS658.1. [P43115-2]
PIRiB55995.
I38747.
I38748.
I38750.
JC2056.
S43375.
S68994. S51313.
S68995. S51315.
S68996. S51316.
S68997. S51317.
S68998. S51318.
S68999. S51319.
RefSeqiNP_001119516.1. NM_001126044.1. [P43115-1]
NP_942007.1. NM_198714.1. [P43115-1]
NP_942008.1. NM_198715.2. [P43115-2]
NP_942009.1. NM_198716.1. [P43115-4]
NP_942010.1. NM_198717.1. [P43115-3]
NP_942011.1. NM_198718.1.
NP_942012.1. NM_198719.1. [P43115-1]
UniGeneiHs.445000.

Genome annotation databases

EnsembliENST00000306666; ENSP00000302313; ENSG00000050628. [P43115-1]
ENST00000370924; ENSP00000359962; ENSG00000050628. [P43115-2]
ENST00000370931; ENSP00000359969; ENSG00000050628. [P43115-1]
ENST00000370932; ENSP00000359970; ENSG00000050628. [P43115-3]
ENST00000414819; ENSP00000401423; ENSG00000050628. [P43115-1]
ENST00000460330; ENSP00000418073; ENSG00000050628. [P43115-4]
ENST00000479353; ENSP00000421583; ENSG00000050628. [P43115-7]
GeneIDi5733.
KEGGihsa:5733.
UCSCiuc001dfg.1. human. [P43115-1]
uc001dfk.1. human. [P43115-4]
uc001dfl.1. human. [P43115-3]
uc001dfq.3. human. [P43115-2]

Polymorphism databases

DMDMi1172071.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
S69200 mRNA. Translation: AAB29854.1 .
L27488 mRNA. Translation: AAC13372.1 .
L27489 mRNA. Translation: AAC13373.1 .
L27490 mRNA. Translation: AAC13374.1 .
X83857 mRNA. Translation: CAA58737.1 .
X83858 mRNA. Translation: CAA58738.1 .
X83859 mRNA. Translation: CAA58739.1 .
X83860 mRNA. Translation: CAA58740.1 .
X83861 mRNA. Translation: CAA58741.1 .
X83862 mRNA. Translation: CAA58742.1 .
X83863 mRNA. Translation: CAA58743.1 .
L26976 mRNA. Translation: AAA60076.1 .
S69326 mRNA. Translation: AAB30208.1 .
L32660 mRNA. Translation: AAA68191.1 .
L32661 mRNA. Translation: AAA68192.1 .
L32662 mRNA. Translation: AAA68193.1 .
D38297 mRNA. Translation: BAA07416.1 .
D38298 mRNA. Translation: BAA07417.1 .
D38299 mRNA. Translation: BAA07418.1 .
D38300 mRNA. Translation: BAA07419.1 .
D38301 mRNA. Translation: BAA07420.1 .
U13214 mRNA. Translation: AAA21130.1 .
U13215 mRNA. Translation: AAA21131.1 .
U13216 mRNA. Translation: AAA21132.1 .
U13217 mRNA. Translation: AAA21133.1 .
U13218 mRNA. Translation: AAA21134.1 .
D86096 Genomic DNA. Translation: BAA19951.1 .
D86096 Genomic DNA. Translation: BAA19952.1 .
D86096 Genomic DNA. Translation: BAA19954.1 .
D86096 Genomic DNA. Translation: BAA19956.1 .
D86096 Genomic DNA. Translation: BAA19957.1 .
D86098 mRNA. Translation: BAA19959.1 .
AY429108 mRNA. Translation: AAR07903.1 .
AK315825 mRNA. Translation: BAF98716.1 .
AB451481 mRNA. Translation: BAG70295.1 .
AL031429 Genomic DNA. Translation: CAI20226.1 .
AL031429 Genomic DNA. Translation: CAI20227.1 .
AL031429 , AL158087 Genomic DNA. Translation: CAI20228.1 .
AL158087 , AL031429 Genomic DNA. Translation: CAI23437.1 .
AL031429 Genomic DNA. Translation: CAB52459.1 .
CH471059 Genomic DNA. Translation: EAX06439.1 .
CH471059 Genomic DNA. Translation: EAX06446.1 .
BC024229 mRNA. Translation: AAH24229.1 .
CCDSi CCDS44160.1. [P43115-3 ]
CCDS652.1. [P43115-4 ]
CCDS656.1. [P43115-1 ]
CCDS657.1. [P43115-1 ]
CCDS658.1. [P43115-2 ]
PIRi B55995.
I38747.
I38748.
I38750.
JC2056.
S43375.
S68994. S51313.
S68995. S51315.
S68996. S51316.
S68997. S51317.
S68998. S51318.
S68999. S51319.
RefSeqi NP_001119516.1. NM_001126044.1. [P43115-1 ]
NP_942007.1. NM_198714.1. [P43115-1 ]
NP_942008.1. NM_198715.2. [P43115-2 ]
NP_942009.1. NM_198716.1. [P43115-4 ]
NP_942010.1. NM_198717.1. [P43115-3 ]
NP_942011.1. NM_198718.1.
NP_942012.1. NM_198719.1. [P43115-1 ]
UniGenei Hs.445000.

3D structure databases

ProteinModelPortali P43115.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111705. 2 interactions.
STRINGi 9606.ENSP00000349003.

Chemistry

BindingDBi P43115.
ChEMBLi CHEMBL3710.
DrugBanki DB00905. Bimatoprost.
GuidetoPHARMACOLOGYi 342.

Protein family/group databases

GPCRDBi Search...

Polymorphism databases

DMDMi 1172071.

Proteomic databases

PaxDbi P43115.
PRIDEi P43115.

Protocols and materials databases

DNASUi 5733.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000306666 ; ENSP00000302313 ; ENSG00000050628 . [P43115-1 ]
ENST00000370924 ; ENSP00000359962 ; ENSG00000050628 . [P43115-2 ]
ENST00000370931 ; ENSP00000359969 ; ENSG00000050628 . [P43115-1 ]
ENST00000370932 ; ENSP00000359970 ; ENSG00000050628 . [P43115-3 ]
ENST00000414819 ; ENSP00000401423 ; ENSG00000050628 . [P43115-1 ]
ENST00000460330 ; ENSP00000418073 ; ENSG00000050628 . [P43115-4 ]
ENST00000479353 ; ENSP00000421583 ; ENSG00000050628 . [P43115-7 ]
GeneIDi 5733.
KEGGi hsa:5733.
UCSCi uc001dfg.1. human. [P43115-1 ]
uc001dfk.1. human. [P43115-4 ]
uc001dfl.1. human. [P43115-3 ]
uc001dfq.3. human. [P43115-2 ]

Organism-specific databases

CTDi 5733.
GeneCardsi GC01M071318.
H-InvDB HIX0029392.
HGNCi HGNC:9595. PTGER3.
HPAi HPA010689.
MIMi 176806. gene.
neXtProti NX_P43115.
PharmGKBi PA288.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG244691.
HOVERGENi HBG052720.
KOi K04260.
OrthoDBi EOG70W3D9.
PhylomeDBi P43115.

Enzyme and pathway databases

Reactomei REACT_18425. Prostanoid ligand receptors.
REACT_19231. G alpha (i) signalling events.

Miscellaneous databases

GenomeRNAii 5733.
NextBioi 22302.
PROi P43115.
SOURCEi Search...

Gene expression databases

ArrayExpressi P43115.
Bgeei P43115.
CleanExi HS_PTGER3.
Genevestigatori P43115.

Family and domain databases

Gene3Di 1.20.1070.10. 1 hit.
InterProi IPR001481. EP3_rcpt_2.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view ]
PANTHERi PTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
Pfami PF00001. 7tm_1. 1 hit.
[Graphical view ]
PRINTSi PR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00584. PRSTNOIDE32R.
PR00582. PRSTNOIDEP3R.
PROSITEi PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and expression of three isoforms of the human EP3 prostanoid receptor."
    Adam M., Boie Y., Rushmore T.H., Mueller G., Bastien L., McKee K.T., Metters K.M., Abramovitz M.
    FEBS Lett. 338:170-174(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B AND EP3C).
  2. "Splice variants of the human EP3 receptor for prostaglandin E2."
    Schmid A., Thierauch K.H., Schleuning W.-D., Dinter H.
    Eur. J. Biochem. 228:23-30(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B; EP3C; EP3D; EP3E AND EP3F).
    Tissue: Uterus.
  3. "Cloning and expression of the EP3-subtype of human receptors for prostaglandin E2."
    Yang J., Xia M., Goetzl E.J., An S.
    Biochem. Biophys. Res. Commun. 198:999-1006(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EP3A).
    Tissue: Kidney.
  4. "Cloning and expression of a prostaglandin E receptor EP3 subtype from human erythroleukaemia cells."
    Kunapuli S.P., Fen Mao G., Bastepe M., Liu-Chen L.-Y., Li S., Cheung P.P., DeRiel J.K., Ashby B.
    Biochem. J. 298:263-267(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EP3A).
  5. "Isoforms of the EP3 subtype of human prostaglandin E2 receptor transduce both intracellular calcium and cAMP signals."
    An S., Yang J., So S.W., Zeng L., Goetzl E.J.
    Biochemistry 33:14496-14502(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3B; EP3C AND EP3D).
    Tissue: Uterus.
  6. "Molecular cloning and expression of multiple isoforms of human prostaglandin E receptor EP3 subtype generated by alternative messenger RNA splicing: multiple second messenger systems and tissue-specific distributions."
    Kotani M., Tanaka I., Ogawa Y., Usui T., Mori K., Ichikawa A., Narumiya S., Yoshimi T., Nakao K.
    Mol. Pharmacol. 48:869-879(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B; EP3C AND EP3D).
    Tissue: Kidney.
  7. "Molecular cloning and expression of human EP3 receptors: evidence of three variants with differing carboxyl termini."
    Regan J.W., Bailey T.J., Donello J.E., Pierce K.L., Pepperl D.J., Zhang D., Kedzie K.M., Fairbairn C.E., Bogardus A.M., Woodward D.F., Gil D.W.
    Br. J. Pharmacol. 112:377-385(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B; EP3C AND EP3D).
    Tissue: Small intestine.
  8. "Structural organization of the human prostaglandin EP3 receptor subtype gene (PTGER3)."
    Kotani M., Tanaka I., Ogawa Y., Usui T., Tamura N., Mori K., Narumiya S., Yoshimi T., Nakao K.
    Genomics 40:425-434(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS EP3C; EP3E; EP3-III; EP3-IV; EP3-V AND EP3E2), ALTERNATIVE SPLICING.
  9. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
    Kopatz S.A., Aronstam R.S., Sharma S.V.
    Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3G).
    Tissue: Placenta.
  10. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3A).
  11. "Human protein factory for converting the transcriptome into an in vitro-expressed proteome."
    Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B.
    , Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.
    Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3B).
  12. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  13. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  14. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3D).
    Tissue: Lung.
  15. Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiPE2R3_HUMAN
AccessioniPrimary (citable) accession number: P43115
Secondary accession number(s): B0AZN4
, B5BUP5, O00326, Q12943, Q12944, Q12945, Q16546, Q5CZ59, Q5CZ62, Q5CZ63, Q5CZ64
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: September 3, 2014
This is version 146 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi