Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P43115

- PE2R3_HUMAN

UniProt

P43115 - PE2R3_HUMAN

Protein

Prostaglandin E2 receptor EP3 subtype

Gene

PTGER3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 147 (01 Oct 2014)
      Sequence version 1 (01 Nov 1995)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems By similarity.By similarity

    GO - Molecular functioni

    1. ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity Source: ProtInc
    2. prostaglandin E receptor activity Source: UniProtKB

    GO - Biological processi

    1. cell death Source: ProtInc
    2. G-protein coupled receptor signaling pathway Source: ProtInc
    3. intracellular receptor signaling pathway Source: GOC
    4. positive regulation of fever generation Source: BHF-UCL
    5. transcription, DNA-templated Source: ProtInc

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Enzyme and pathway databases

    ReactomeiREACT_18425. Prostanoid ligand receptors.
    REACT_19231. G alpha (i) signalling events.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Prostaglandin E2 receptor EP3 subtype
    Short name:
    PGE receptor EP3 subtype
    Short name:
    PGE2 receptor EP3 subtype
    Alternative name(s):
    PGE2-R
    Prostanoid EP3 receptor
    Gene namesi
    Name:PTGER3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:9595. PTGER3.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB
    2. integral component of plasma membrane Source: ProtInc
    3. nuclear envelope Source: ProtInc
    4. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA288.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 390390Prostaglandin E2 receptor EP3 subtypePRO_0000070058Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi18 – 181N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi36 – 361N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein, Lipoprotein, Palmitate

    Proteomic databases

    PaxDbiP43115.
    PRIDEiP43115.

    Expressioni

    Tissue specificityi

    Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels.1 Publication

    Gene expression databases

    ArrayExpressiP43115.
    BgeeiP43115.
    CleanExiHS_PTGER3.
    GenevestigatoriP43115.

    Organism-specific databases

    HPAiHPA010689.

    Interactioni

    Protein-protein interaction databases

    BioGridi111705. 2 interactions.
    STRINGi9606.ENSP00000349003.

    Structurei

    3D structure databases

    ProteinModelPortaliP43115.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 5353ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini79 – 9113CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini113 – 13119ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini154 – 17522CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini198 – 22730ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini254 – 28330CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini308 – 32720ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini350 – 39041CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei54 – 7825Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei92 – 11221Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei132 – 15322Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei176 – 19722Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei228 – 25326Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei284 – 30724Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei328 – 34922Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG244691.
    HOGENOMiHOG000015238.
    HOVERGENiHBG052720.
    KOiK04260.
    OMAiFPITMLI.
    OrthoDBiEOG70W3D9.
    PhylomeDBiP43115.
    TreeFamiTF324982.

    Family and domain databases

    Gene3Di1.20.1070.10. 1 hit.
    InterProiIPR001481. EP3_rcpt_2.
    IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    IPR008365. Prostanoid_rcpt.
    IPR001244. Prostglndn_DP_rcpt.
    IPR000265. Prostglndn_EP3_rcpt.
    [Graphical view]
    PANTHERiPTHR11866. PTHR11866. 1 hit.
    PTHR11866:SF10. PTHR11866:SF10. 1 hit.
    PfamiPF00001. 7tm_1. 1 hit.
    [Graphical view]
    PRINTSiPR00237. GPCRRHODOPSN.
    PR00428. PROSTAGLNDNR.
    PR01788. PROSTANOIDR.
    PR00584. PRSTNOIDE32R.
    PR00582. PRSTNOIDEP3R.
    PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view]

    Sequences (11)i

    Sequence statusi: Complete.

    This entry describes 11 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform EP3A (identifier: P43115-1) [UniParc]FASTAAdd to Basket

    Also known as: EP3-I, EP3a1, EP3a2, EP(3-Ic)

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKETRGYGGD APFCTRLNHS YTGMWAPERS AEARGNLTRP PGSGEDCGSV    50
    SVAFPITMLL TGFVGNALAM LLVSRSYRRR ESKRKKSFLL CIGWLALTDL 100
    VGQLLTTPVV IVVYLSKQRW EHIDPSGRLC TFFGLTMTVF GLSSLFIASA 150
    MAVERALAIR APHWYASHMK TRATRAVLLG VWLAVLAFAL LPVLGVGQYT 200
    VQWPGTWCFI STGRGGNGTS SSHNWGNLFF ASAFAFLGLL ALTVTFSCNL 250
    ATIKALVSRC RAKATASQSS AQWGRITTET AIQLMGIMCV LSVCWSPLLI 300
    MMLKMIFNQT SVEHCKTHTE KQKECNFFLI AVRLASLNQI LDPWVYLLLR 350
    KILLRKFCQI RYHTNNYASS STSLPCQCSS TLMWSDHLER 390
    Length:390
    Mass (Da):43,310
    Last modified:November 1, 1995 - v1
    Checksum:iBC76EAC78FDF5420
    GO
    Isoform EP3C (identifier: P43115-2) [UniParc]FASTAAdd to Basket

    Also known as: EP3-II

    The sequence of this isoform differs from the canonical sequence as follows:
         360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEA

    Note: Known as EP3D in PubMed:8075855.

    Show »
    Length:388
    Mass (Da):42,682
    Checksum:i96ED050A946BDC5F
    GO
    Isoform EP3B (identifier: P43115-3) [UniParc]FASTAAdd to Basket

    Also known as: EP3-III

    The sequence of this isoform differs from the canonical sequence as follows:
         360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → EEFWGN

    Note: Known as EP3E in PubMed:8075855.

    Show »
    Length:365
    Mass (Da):40,502
    Checksum:i1AA2E95EB596EB46
    GO
    Isoform EP3D (identifier: P43115-4) [UniParc]FASTAAdd to Basket

    Also known as: EP3-IV

    The sequence of this isoform differs from the canonical sequence as follows:
         360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQEEFWGN

    Note: Known as EP3F in PubMed:8075855.

    Show »
    Length:374
    Mass (Da):41,756
    Checksum:i431BF492DBA231DE
    GO
    Isoform EP3E (identifier: P43115-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQL...YTRISTVKTE

    Show »
    Length:418
    Mass (Da):46,687
    Checksum:i9FAA12E0E24405D3
    GO
    Isoform EP3F (identifier: P43115-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQA...LREPCSVQLS

    Show »
    Length:425
    Mass (Da):47,332
    Checksum:i65447F57530539F8
    GO
    Isoform EP3G (identifier: P43115-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → EMGPDGRCFCHAWRQVPRTWCSSHDREPCSVQLS

    Show »
    Length:393
    Mass (Da):43,683
    Checksum:i3E9981F9C4389606
    GO
    Isoform EP3-III (identifier: P43115-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEAEEFWGN

    Show »
    Length:394
    Mass (Da):43,445
    Checksum:i633646EC3F2576ED
    GO
    Isoform EP3-IV (identifier: P43115-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEAMRKRRLREQEEFWGN

    Show »
    Length:403
    Mass (Da):44,699
    Checksum:i599101B5BD1426C7
    GO
    Isoform EP3-V (identifier: P43115-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSN...DREPCSVQLS

    Show »
    Length:431
    Mass (Da):47,881
    Checksum:i10C8E00EB53C1CEB
    GO
    Isoform EP3E2 (identifier: P43115-11) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSN...IVGKYKPIVC

    Show »
    Length:422
    Mass (Da):46,849
    Checksum:i0EAD22290C4C2B22
    GO

    Sequence cautioni

    The sequence CAA58742.1 differs from that shown. Reason: Frameshift at position 374.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti28 – 292ER → DG(PubMed:8117308)Curated
    Sequence conflicti28 – 292ER → DG(PubMed:8135729)Curated
    Sequence conflicti28 – 292ER → DG(PubMed:8075855)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti169 – 1691M → L.
    Corresponds to variant rs5670 [ dbSNP | Ensembl ].
    VAR_014694
    Natural varianti319 – 3191T → M.
    Corresponds to variant rs13306020 [ dbSNP | Ensembl ].
    VAR_049436
    Natural varianti366 – 3661N → S.
    Corresponds to variant rs13306014 [ dbSNP | Ensembl ].
    VAR_029218
    Natural varianti375 – 3751P → L.
    Corresponds to variant rs5694 [ dbSNP | Ensembl ].
    VAR_014695

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAEEFWGN in isoform EP3-III. 1 PublicationVSP_053774Add
    BLAST
    Alternative sequencei360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQEE FWGN in isoform EP3-IV. 1 PublicationVSP_053775Add
    BLAST
    Alternative sequencei360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQEM GPDGRCFCHAWRQVPRTWCS SHDREPCSVQLS in isoform EP3-V. 1 PublicationVSP_053776Add
    BLAST
    Alternative sequencei360 – 39031IRYHT…DHLER → EEFWGN in isoform EP3B. 7 PublicationsVSP_001936Add
    BLAST
    Alternative sequencei360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEA in isoform EP3C. 6 PublicationsVSP_001935Add
    BLAST
    Alternative sequencei360 – 39031IRYHT…DHLER → MRKRRLREQEEFWGN in isoform EP3D. 6 PublicationsVSP_001937Add
    BLAST
    Alternative sequencei360 – 39031IRYHT…DHLER → MRKRRLREQLICSLQNSQIQ RATAHCGQVQTYRVLNREEM EVLVSSINVYTRISTVKTE in isoform EP3E. 2 PublicationsVSP_001938Add
    BLAST
    Alternative sequencei360 – 39031IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEAMRKRRLREQLI CSLRTLRYRGQLHIVGKYKP IVC in isoform EP3E2. 1 PublicationVSP_053777Add
    BLAST
    Alternative sequencei360 – 39031IRYHT…DHLER → MRKRRLREQAPLLPTPTVID PSRFCAQPFRWFLDLSFPAM SSSHPQLPLTLASFKLLREP CSVQLS in isoform EP3F. 1 PublicationVSP_001939Add
    BLAST
    Alternative sequencei360 – 39031IRYHT…DHLER → EMGPDGRCFCHAWRQVPRTW CSSHDREPCSVQLS in isoform EP3G. 1 PublicationVSP_013271Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    S69200 mRNA. Translation: AAB29854.1.
    L27488 mRNA. Translation: AAC13372.1.
    L27489 mRNA. Translation: AAC13373.1.
    L27490 mRNA. Translation: AAC13374.1.
    X83857 mRNA. Translation: CAA58737.1.
    X83858 mRNA. Translation: CAA58738.1.
    X83859 mRNA. Translation: CAA58739.1.
    X83860 mRNA. Translation: CAA58740.1.
    X83861 mRNA. Translation: CAA58741.1.
    X83862 mRNA. Translation: CAA58742.1. Frameshift.
    X83863 mRNA. Translation: CAA58743.1.
    L26976 mRNA. Translation: AAA60076.1.
    S69326 mRNA. Translation: AAB30208.1.
    L32660 mRNA. Translation: AAA68191.1.
    L32661 mRNA. Translation: AAA68192.1.
    L32662 mRNA. Translation: AAA68193.1.
    D38297 mRNA. Translation: BAA07416.1.
    D38298 mRNA. Translation: BAA07417.1.
    D38299 mRNA. Translation: BAA07418.1.
    D38300 mRNA. Translation: BAA07419.1.
    D38301 mRNA. Translation: BAA07420.1.
    U13214 mRNA. Translation: AAA21130.1.
    U13215 mRNA. Translation: AAA21131.1.
    U13216 mRNA. Translation: AAA21132.1.
    U13217 mRNA. Translation: AAA21133.1.
    U13218 mRNA. Translation: AAA21134.1.
    D86096 Genomic DNA. Translation: BAA19951.1.
    D86096 Genomic DNA. Translation: BAA19952.1.
    D86096 Genomic DNA. Translation: BAA19954.1.
    D86096 Genomic DNA. Translation: BAA19956.1.
    D86096 Genomic DNA. Translation: BAA19957.1.
    D86098 mRNA. Translation: BAA19959.1.
    AY429108 mRNA. Translation: AAR07903.1.
    AK315825 mRNA. Translation: BAF98716.1.
    AB451481 mRNA. Translation: BAG70295.1.
    AL031429 Genomic DNA. Translation: CAI20226.1.
    AL031429 Genomic DNA. Translation: CAI20227.1.
    AL031429, AL158087 Genomic DNA. Translation: CAI20228.1.
    AL158087, AL031429 Genomic DNA. Translation: CAI23437.1.
    AL031429 Genomic DNA. Translation: CAB52459.1.
    CH471059 Genomic DNA. Translation: EAX06439.1.
    CH471059 Genomic DNA. Translation: EAX06446.1.
    BC024229 mRNA. Translation: AAH24229.1.
    CCDSiCCDS44160.1. [P43115-3]
    CCDS652.1. [P43115-4]
    CCDS656.1. [P43115-1]
    CCDS657.1. [P43115-1]
    CCDS658.1. [P43115-2]
    PIRiB55995.
    I38747.
    I38748.
    I38750.
    JC2056.
    S43375.
    S68994. S51313.
    S68995. S51315.
    S68996. S51316.
    S68997. S51317.
    S68998. S51318.
    S68999. S51319.
    RefSeqiNP_001119516.1. NM_001126044.1. [P43115-1]
    NP_942007.1. NM_198714.1. [P43115-1]
    NP_942008.1. NM_198715.2. [P43115-2]
    NP_942009.1. NM_198716.1. [P43115-4]
    NP_942010.1. NM_198717.1. [P43115-3]
    NP_942011.1. NM_198718.1.
    NP_942012.1. NM_198719.1. [P43115-1]
    UniGeneiHs.445000.

    Genome annotation databases

    EnsembliENST00000306666; ENSP00000302313; ENSG00000050628. [P43115-1]
    ENST00000356595; ENSP00000349003; ENSG00000050628.
    ENST00000370924; ENSP00000359962; ENSG00000050628. [P43115-2]
    ENST00000370931; ENSP00000359969; ENSG00000050628. [P43115-1]
    ENST00000370932; ENSP00000359970; ENSG00000050628. [P43115-3]
    ENST00000460330; ENSP00000418073; ENSG00000050628. [P43115-4]
    ENST00000479353; ENSP00000421583; ENSG00000050628. [P43115-7]
    GeneIDi5733.
    KEGGihsa:5733.
    UCSCiuc001dfg.1. human. [P43115-1]
    uc001dfk.1. human. [P43115-4]
    uc001dfl.1. human. [P43115-3]
    uc001dfo.3. human.
    uc001dfq.3. human. [P43115-2]

    Polymorphism databases

    DMDMi1172071.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    S69200 mRNA. Translation: AAB29854.1 .
    L27488 mRNA. Translation: AAC13372.1 .
    L27489 mRNA. Translation: AAC13373.1 .
    L27490 mRNA. Translation: AAC13374.1 .
    X83857 mRNA. Translation: CAA58737.1 .
    X83858 mRNA. Translation: CAA58738.1 .
    X83859 mRNA. Translation: CAA58739.1 .
    X83860 mRNA. Translation: CAA58740.1 .
    X83861 mRNA. Translation: CAA58741.1 .
    X83862 mRNA. Translation: CAA58742.1 . Frameshift.
    X83863 mRNA. Translation: CAA58743.1 .
    L26976 mRNA. Translation: AAA60076.1 .
    S69326 mRNA. Translation: AAB30208.1 .
    L32660 mRNA. Translation: AAA68191.1 .
    L32661 mRNA. Translation: AAA68192.1 .
    L32662 mRNA. Translation: AAA68193.1 .
    D38297 mRNA. Translation: BAA07416.1 .
    D38298 mRNA. Translation: BAA07417.1 .
    D38299 mRNA. Translation: BAA07418.1 .
    D38300 mRNA. Translation: BAA07419.1 .
    D38301 mRNA. Translation: BAA07420.1 .
    U13214 mRNA. Translation: AAA21130.1 .
    U13215 mRNA. Translation: AAA21131.1 .
    U13216 mRNA. Translation: AAA21132.1 .
    U13217 mRNA. Translation: AAA21133.1 .
    U13218 mRNA. Translation: AAA21134.1 .
    D86096 Genomic DNA. Translation: BAA19951.1 .
    D86096 Genomic DNA. Translation: BAA19952.1 .
    D86096 Genomic DNA. Translation: BAA19954.1 .
    D86096 Genomic DNA. Translation: BAA19956.1 .
    D86096 Genomic DNA. Translation: BAA19957.1 .
    D86098 mRNA. Translation: BAA19959.1 .
    AY429108 mRNA. Translation: AAR07903.1 .
    AK315825 mRNA. Translation: BAF98716.1 .
    AB451481 mRNA. Translation: BAG70295.1 .
    AL031429 Genomic DNA. Translation: CAI20226.1 .
    AL031429 Genomic DNA. Translation: CAI20227.1 .
    AL031429 , AL158087 Genomic DNA. Translation: CAI20228.1 .
    AL158087 , AL031429 Genomic DNA. Translation: CAI23437.1 .
    AL031429 Genomic DNA. Translation: CAB52459.1 .
    CH471059 Genomic DNA. Translation: EAX06439.1 .
    CH471059 Genomic DNA. Translation: EAX06446.1 .
    BC024229 mRNA. Translation: AAH24229.1 .
    CCDSi CCDS44160.1. [P43115-3 ]
    CCDS652.1. [P43115-4 ]
    CCDS656.1. [P43115-1 ]
    CCDS657.1. [P43115-1 ]
    CCDS658.1. [P43115-2 ]
    PIRi B55995.
    I38747.
    I38748.
    I38750.
    JC2056.
    S43375.
    S68994. S51313.
    S68995. S51315.
    S68996. S51316.
    S68997. S51317.
    S68998. S51318.
    S68999. S51319.
    RefSeqi NP_001119516.1. NM_001126044.1. [P43115-1 ]
    NP_942007.1. NM_198714.1. [P43115-1 ]
    NP_942008.1. NM_198715.2. [P43115-2 ]
    NP_942009.1. NM_198716.1. [P43115-4 ]
    NP_942010.1. NM_198717.1. [P43115-3 ]
    NP_942011.1. NM_198718.1.
    NP_942012.1. NM_198719.1. [P43115-1 ]
    UniGenei Hs.445000.

    3D structure databases

    ProteinModelPortali P43115.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111705. 2 interactions.
    STRINGi 9606.ENSP00000349003.

    Chemistry

    BindingDBi P43115.
    ChEMBLi CHEMBL3710.
    DrugBanki DB00905. Bimatoprost.
    GuidetoPHARMACOLOGYi 342.

    Protein family/group databases

    GPCRDBi Search...

    Polymorphism databases

    DMDMi 1172071.

    Proteomic databases

    PaxDbi P43115.
    PRIDEi P43115.

    Protocols and materials databases

    DNASUi 5733.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000306666 ; ENSP00000302313 ; ENSG00000050628 . [P43115-1 ]
    ENST00000356595 ; ENSP00000349003 ; ENSG00000050628 .
    ENST00000370924 ; ENSP00000359962 ; ENSG00000050628 . [P43115-2 ]
    ENST00000370931 ; ENSP00000359969 ; ENSG00000050628 . [P43115-1 ]
    ENST00000370932 ; ENSP00000359970 ; ENSG00000050628 . [P43115-3 ]
    ENST00000460330 ; ENSP00000418073 ; ENSG00000050628 . [P43115-4 ]
    ENST00000479353 ; ENSP00000421583 ; ENSG00000050628 . [P43115-7 ]
    GeneIDi 5733.
    KEGGi hsa:5733.
    UCSCi uc001dfg.1. human. [P43115-1 ]
    uc001dfk.1. human. [P43115-4 ]
    uc001dfl.1. human. [P43115-3 ]
    uc001dfo.3. human.
    uc001dfq.3. human. [P43115-2 ]

    Organism-specific databases

    CTDi 5733.
    GeneCardsi GC01M071318.
    H-InvDB HIX0029392.
    HGNCi HGNC:9595. PTGER3.
    HPAi HPA010689.
    MIMi 176806. gene.
    neXtProti NX_P43115.
    PharmGKBi PA288.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG244691.
    HOGENOMi HOG000015238.
    HOVERGENi HBG052720.
    KOi K04260.
    OMAi FPITMLI.
    OrthoDBi EOG70W3D9.
    PhylomeDBi P43115.
    TreeFami TF324982.

    Enzyme and pathway databases

    Reactomei REACT_18425. Prostanoid ligand receptors.
    REACT_19231. G alpha (i) signalling events.

    Miscellaneous databases

    GenomeRNAii 5733.
    NextBioi 22302.
    PROi P43115.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P43115.
    Bgeei P43115.
    CleanExi HS_PTGER3.
    Genevestigatori P43115.

    Family and domain databases

    Gene3Di 1.20.1070.10. 1 hit.
    InterProi IPR001481. EP3_rcpt_2.
    IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    IPR008365. Prostanoid_rcpt.
    IPR001244. Prostglndn_DP_rcpt.
    IPR000265. Prostglndn_EP3_rcpt.
    [Graphical view ]
    PANTHERi PTHR11866. PTHR11866. 1 hit.
    PTHR11866:SF10. PTHR11866:SF10. 1 hit.
    Pfami PF00001. 7tm_1. 1 hit.
    [Graphical view ]
    PRINTSi PR00237. GPCRRHODOPSN.
    PR00428. PROSTAGLNDNR.
    PR01788. PROSTANOIDR.
    PR00584. PRSTNOIDE32R.
    PR00582. PRSTNOIDEP3R.
    PROSITEi PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and expression of three isoforms of the human EP3 prostanoid receptor."
      Adam M., Boie Y., Rushmore T.H., Mueller G., Bastien L., McKee K.T., Metters K.M., Abramovitz M.
      FEBS Lett. 338:170-174(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B AND EP3C).
    2. "Splice variants of the human EP3 receptor for prostaglandin E2."
      Schmid A., Thierauch K.H., Schleuning W.-D., Dinter H.
      Eur. J. Biochem. 228:23-30(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B; EP3C; EP3D; EP3E AND EP3F).
      Tissue: Uterus.
    3. "Cloning and expression of the EP3-subtype of human receptors for prostaglandin E2."
      Yang J., Xia M., Goetzl E.J., An S.
      Biochem. Biophys. Res. Commun. 198:999-1006(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EP3A).
      Tissue: Kidney.
    4. "Cloning and expression of a prostaglandin E receptor EP3 subtype from human erythroleukaemia cells."
      Kunapuli S.P., Fen Mao G., Bastepe M., Liu-Chen L.-Y., Li S., Cheung P.P., DeRiel J.K., Ashby B.
      Biochem. J. 298:263-267(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EP3A).
    5. "Isoforms of the EP3 subtype of human prostaglandin E2 receptor transduce both intracellular calcium and cAMP signals."
      An S., Yang J., So S.W., Zeng L., Goetzl E.J.
      Biochemistry 33:14496-14502(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3B; EP3C AND EP3D).
      Tissue: Uterus.
    6. "Molecular cloning and expression of multiple isoforms of human prostaglandin E receptor EP3 subtype generated by alternative messenger RNA splicing: multiple second messenger systems and tissue-specific distributions."
      Kotani M., Tanaka I., Ogawa Y., Usui T., Mori K., Ichikawa A., Narumiya S., Yoshimi T., Nakao K.
      Mol. Pharmacol. 48:869-879(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B; EP3C AND EP3D).
      Tissue: Kidney.
    7. "Molecular cloning and expression of human EP3 receptors: evidence of three variants with differing carboxyl termini."
      Regan J.W., Bailey T.J., Donello J.E., Pierce K.L., Pepperl D.J., Zhang D., Kedzie K.M., Fairbairn C.E., Bogardus A.M., Woodward D.F., Gil D.W.
      Br. J. Pharmacol. 112:377-385(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B; EP3C AND EP3D).
      Tissue: Small intestine.
    8. "Structural organization of the human prostaglandin EP3 receptor subtype gene (PTGER3)."
      Kotani M., Tanaka I., Ogawa Y., Usui T., Tamura N., Mori K., Narumiya S., Yoshimi T., Nakao K.
      Genomics 40:425-434(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS EP3C; EP3E; EP3-III; EP3-IV; EP3-V AND EP3E2), ALTERNATIVE SPLICING.
    9. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
      Kopatz S.A., Aronstam R.S., Sharma S.V.
      Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3G).
      Tissue: Placenta.
    10. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3A).
    11. "Human protein factory for converting the transcriptome into an in vitro-expressed proteome."
      Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B.
      , Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.
      Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3B).
    12. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    13. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    14. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3D).
      Tissue: Lung.
    15. Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiPE2R3_HUMAN
    AccessioniPrimary (citable) accession number: P43115
    Secondary accession number(s): B0AZN4
    , B1AK19, B5BUP5, O00326, Q12943, Q12944, Q12945, Q16546, Q5CZ59, Q5CZ62, Q5CZ63, Q5CZ64
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1995
    Last sequence update: November 1, 1995
    Last modified: October 1, 2014
    This is version 147 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3