P43115 (PE2R3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 134.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Prostaglandin E2 receptor EP3 subtype Short name=PGE receptor EP3 subtype Short name=PGE2 receptor EP3 subtype Alternative name(s): PGE2-R Prostanoid EP3 receptor | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 390 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems By similarity. |
| Subcellular location | |
| Tissue specificity | Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels. Ref.15 |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Glycoprotein Lipoprotein Palmitate |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell death Traceable author statement PubMed 10947062. Source: ProtInc positive regulation of fever generationInferred from sequence or structural similarity. Source: BHF-UCL |
| Cellular_component | integral to plasma membrane Traceable author statement Ref.1. Source: ProtInc nuclear envelopeTraceable author statement PubMed 10336471. Source: ProtInc |
| Molecular_function | ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity Traceable author statement PubMed 10336471. Source: ProtInc prostaglandin E receptor activityNon-traceable author statement Ref.8. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform EP3A (identifier: P43115-1) Also known as: EP3-I; EP3a1; EP3a2; EP(3-Ic); This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform EP3C (identifier: P43115-2) Also known as: EP3-II; The sequence of this isoform differs from the canonical sequence as follows: 360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → VANAVSSCSNDGQKGQPISLSNEIIQTEA | ||||||
| Note: Known as EP3D in PubMed:8075855. | ||||||
| Isoform EP3B (identifier: P43115-3) Also known as: EP3-III; The sequence of this isoform differs from the canonical sequence as follows: 360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → EEFWGN | ||||||
| Note: Known as EP3E in PubMed:8075855. | ||||||
| Isoform EP3D (identifier: P43115-4) Also known as: EP3-IV; The sequence of this isoform differs from the canonical sequence as follows: 360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQEEFWGN | ||||||
| Note: Known as EP3F in PubMed:8075855. | ||||||
| Isoform EP3E (identifier: P43115-5) The sequence of this isoform differs from the canonical sequence as follows: 360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQLICSLRTLRYRGQLHIVGKYKPIVC | ||||||
| Isoform EP3F (identifier: P43115-6) The sequence of this isoform differs from the canonical sequence as follows: 360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → MRKRRLREQA...LREPCSVQLS | ||||||
| Isoform EP3G (identifier: P43115-7) The sequence of this isoform differs from the canonical sequence as follows: 360-390: IRYHTNNYASSSTSLPCQCSSTLMWSDHLER → EMGPDGRCFCHAWRQVPRTWCSSHDREPCSVQLS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 390 | 390 | Prostaglandin E2 receptor EP3 subtype | PRO_0000070058 | |||||
Regions | |||||||||
| Topological domain | 1 – 53 | 53 | Extracellular Potential | ||||||
| Transmembrane | 54 – 78 | 25 | Helical; Name=1; Potential | ||||||
| Topological domain | 79 – 91 | 13 | Cytoplasmic Potential | ||||||
| Transmembrane | 92 – 112 | 21 | Helical; Name=2; Potential | ||||||
| Topological domain | 113 – 131 | 19 | Extracellular Potential | ||||||
| Transmembrane | 132 – 153 | 22 | Helical; Name=3; Potential | ||||||
| Topological domain | 154 – 175 | 22 | Cytoplasmic Potential | ||||||
| Transmembrane | 176 – 197 | 22 | Helical; Name=4; Potential | ||||||
| Topological domain | 198 – 227 | 30 | Extracellular Potential | ||||||
| Transmembrane | 228 – 253 | 26 | Helical; Name=5; Potential | ||||||
| Topological domain | 254 – 283 | 30 | Cytoplasmic Potential | ||||||
| Transmembrane | 284 – 307 | 24 | Helical; Name=6; Potential | ||||||
| Topological domain | 308 – 327 | 20 | Extracellular Potential | ||||||
| Transmembrane | 328 – 349 | 22 | Helical; Name=7; Potential | ||||||
| Topological domain | 350 – 390 | 41 | Cytoplasmic Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 18 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 36 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 360 – 390 | 31 | IRYHT…DHLER → EEFWGN in isoform EP3B. | VSP_001936 | |||||
| Alternative sequence | 360 – 390 | 31 | IRYHT…DHLER → VANAVSSCSNDGQKGQPISL SNEIIQTEA in isoform EP3C. | VSP_001935 | |||||
| Alternative sequence | 360 – 390 | 31 | IRYHT…DHLER → MRKRRLREQEEFWGN in isoform EP3D. | VSP_001937 | |||||
| Alternative sequence | 360 – 390 | 31 | IRYHT…DHLER → MRKRRLREQLICSLRTLRYR GQLHIVGKYKPIVC in isoform EP3E. | VSP_001938 | |||||
| Alternative sequence | 360 – 390 | 31 | IRYHT…DHLER → MRKRRLREQAPLLPTPTVID PSRFCAQPFRWFLDLSFPAM SSSHPQLPLTLASFKLLREP CSVQLS in isoform EP3F. | VSP_001939 | |||||
| Alternative sequence | 360 – 390 | 31 | IRYHT…DHLER → EMGPDGRCFCHAWRQVPRTW CSSHDREPCSVQLS in isoform EP3G. | VSP_013271 | |||||
| Natural variant | 169 | 1 | M → L. Corresponds to variant rs5670 [ dbSNP | Ensembl ]. | VAR_014694 | |||||
| Natural variant | 319 | 1 | T → M. Corresponds to variant rs13306020 [ dbSNP | Ensembl ]. | VAR_049436 | |||||
| Natural variant | 366 | 1 | N → S. Corresponds to variant rs13306014 [ dbSNP | Ensembl ]. | VAR_029218 | |||||
| Natural variant | 375 | 1 | P → L. Corresponds to variant rs5694 [ dbSNP | Ensembl ]. | VAR_014695 | |||||
Experimental info | |||||||||
| Sequence conflict | 28 – 29 | 2 | ER → DG Ref.3 | ||||||
| Sequence conflict | 28 – 29 | 2 | ER → DG Ref.4 | ||||||
| Sequence conflict | 28 – 29 | 2 | ER → DG Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression of three isoforms of the human EP3 prostanoid receptor." Adam M., Boie Y., Rushmore T.H., Mueller G., Bastien L., McKee K.T., Metters K.M., Abramovitz M. FEBS Lett. 338:170-174(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B AND EP3C). |
| [2] | "Splice variants of the human EP3 receptor for prostaglandin E2." Schmid A., Thierauch K.H., Schleuning W.-D., Dinter H. Eur. J. Biochem. 228:23-30(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B; EP3C; EP3D; EP3E AND EP3F). Tissue: Uterus. |
| [3] | "Cloning and expression of the EP3-subtype of human receptors for prostaglandin E2." Yang J., Xia M., Goetzl E.J., An S. Biochem. Biophys. Res. Commun. 198:999-1006(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EP3A). Tissue: Kidney. |
| [4] | "Cloning and expression of a prostaglandin E receptor EP3 subtype from human erythroleukaemia cells." Kunapuli S.P., Fen Mao G., Bastepe M., Liu-Chen L.-Y., Li S., Cheung P.P., DeRiel J.K., Ashby B. Biochem. J. 298:263-267(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM EP3A). |
| [5] | "Isoforms of the EP3 subtype of human prostaglandin E2 receptor transduce both intracellular calcium and cAMP signals." An S., Yang J., So S.W., Zeng L., Goetzl E.J. Biochemistry 33:14496-14502(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3B; EP3C AND EP3D). Tissue: Uterus. |
| [6] | "Molecular cloning and expression of multiple isoforms of human prostaglandin E receptor EP3 subtype generated by alternative messenger RNA splicing: multiple second messenger systems and tissue-specific distributions." Kotani M., Tanaka I., Ogawa Y., Usui T., Mori K., Ichikawa A., Narumiya S., Yoshimi T., Nakao K. Mol. Pharmacol. 48:869-879(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B; EP3C AND EP3D). Tissue: Kidney. |
| [7] | "Molecular cloning and expression of human EP3 receptors: evidence of three variants with differing carboxyl termini." Regan J.W., Bailey T.J., Donello J.E., Pierce K.L., Pepperl D.J., Zhang D., Kedzie K.M., Fairbairn C.E., Bogardus A.M., Woodward D.F., Gil D.W. Br. J. Pharmacol. 112:377-385(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS EP3A; EP3B; EP3C AND EP3D). Tissue: Small intestine. |
| [8] | "Structural organization of the human prostaglandin EP3 receptor subtype gene (PTGER3)." Kotani M., Tanaka I., Ogawa Y., Usui T., Tamura N., Mori K., Narumiya S., Yoshimi T., Nakao K. Genomics 40:425-434(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [9] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Kopatz S.A., Aronstam R.S., Sharma S.V. Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3G). Tissue: Placenta. |
| [10] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3A). |
| [11] | "Human protein factory for converting the transcriptome into an in vitro-expressed proteome." Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. Nomura N.Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3B). |
| [12] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [13] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [14] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM EP3D). Tissue: Lung. |
| [15] | "A new mRNA splice variant coding for the human EP3-I receptor isoform." Kotelevets L., Foudi N., Louedec L., Couvelard A., Chastre E., Norel X. Prostaglandins Leukot. Essent. Fatty Acids 77:195-201(2007) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | S69200 mRNA. Translation: AAB29854.1. L27488 mRNA. Translation: AAC13372.1. L27489 mRNA. Translation: AAC13373.1. L27490 mRNA. Translation: AAC13374.1. X83857 mRNA. Translation: CAA58737.1. X83858 mRNA. Translation: CAA58738.1. X83859 mRNA. Translation: CAA58739.1. X83860 mRNA. Translation: CAA58740.1. X83861 mRNA. Translation: CAA58741.1. X83862 mRNA. Translation: CAA58742.1. X83863 mRNA. Translation: CAA58743.1. L26976 mRNA. Translation: AAA60076.1. S69326 mRNA. Translation: AAB30208.1. L32660 mRNA. Translation: AAA68191.1. L32661 mRNA. Translation: AAA68192.1. L32662 mRNA. Translation: AAA68193.1. D38297 mRNA. Translation: BAA07416.1. D38298 mRNA. Translation: BAA07417.1. D38299 mRNA. Translation: BAA07418.1. D38300 mRNA. Translation: BAA07419.1. D38301 mRNA. Translation: BAA07420.1. U13214 mRNA. Translation: AAA21130.1. U13215 mRNA. Translation: AAA21131.1. U13216 mRNA. Translation: AAA21132.1. U13217 mRNA. Translation: AAA21133.1. U13218 mRNA. Translation: AAA21134.1. D86096 Genomic DNA. Translation: BAA19951.1. D86098 mRNA. Translation: BAA19959.1. AY429108 mRNA. Translation: AAR07903.1. AK315825 mRNA. Translation: BAF98716.1. AB451481 mRNA. Translation: BAG70295.1. AL031429 Genomic DNA. Translation: CAI20226.1. AL031429 Genomic DNA. Translation: CAI20227.1. AL031429, AL158087 Genomic DNA. Translation: CAI20228.1. AL158087, AL031429 Genomic DNA. Translation: CAI23437.1. AL031429 Genomic DNA. Translation: CAB52459.1. CH471059 Genomic DNA. Translation: EAX06439.1. BC024229 mRNA. Translation: AAH24229.1. |
| IPI | IPI00221021. IPI00394835. IPI00395012. IPI00411362. IPI00478116. IPI00889746. IPI01010513. |
| PIR | B55995. I38747. I38748. I38750. JC2056. S43375. S51313. S68994. S51315. S68995. S51316. S68996. S51317. S68997. S51318. S68998. S51319. S68999. |
| RefSeq | NP_001119516.1. NM_001126044.1. NP_942007.1. NM_198714.1. NP_942008.1. NM_198715.2. NP_942009.1. NM_198716.1. NP_942010.1. NM_198717.1. NP_942011.1. NM_198718.1. NP_942012.1. NM_198719.1. |
| UniGene | Hs.445000. |
3D structure databases | |
| ProteinModelPortal | P43115. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000349003. |
Protein family/group databases | |
| GPCRDB | Search... |
Polymorphism databases | |
| DMDM | 1172071. |
Proteomic databases | |
| PaxDb | P43115. |
| PRIDE | P43115. |
Protocols and materials databases | |
| DNASU | 5733. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000306666; ENSP00000302313; ENSG00000050628. ENST00000370924; ENSP00000359962; ENSG00000050628. ENST00000370931; ENSP00000359969; ENSG00000050628. ENST00000370932; ENSP00000359970; ENSG00000050628. ENST00000414819; ENSP00000401423; ENSG00000050628. ENST00000460330; ENSP00000418073; ENSG00000050628. ENST00000479353; ENSP00000421583; ENSG00000050628. |
| GeneID | 5733. |
| KEGG | hsa:5733. |
| UCSC | uc001dfg.1. human. uc001dfk.1. human. uc001dfl.1. human. uc001dfq.3. human. |
Organism-specific databases | |
| CTD | 5733. |
| GeneCards | GC01M071318. |
| H-InvDB | HIX0029392. |
| HGNC | HGNC:9595. PTGER3. |
| HPA | HPA010689. |
| MIM | 176806. gene. |
| neXtProt | NX_P43115. |
| PharmGKB | PA288. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG244691. |
| HOVERGEN | HBG052720. |
| KO | K04260. |
| OrthoDB | EOG42Z4QP. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | P43115. |
| Bgee | P43115. |
| CleanEx | HS_PTGER3. |
| Genevestigator | P43115. |
| GermOnline | ENSG00000050628. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001481. EP3_rcpt_2. IPR000276. GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_7TM. IPR008365. Prostanoid_rcpt. IPR001244. Prostglndn_DP_rcpt. IPR000265. Prostglndn_EP3_rcpt. [Graphical view] |
| PANTHER | PTHR11866. PTHR11866. 1 hit. PTHR11866:SF10. PTHR11866:SF10. 1 hit. |
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] |
| PRINTS | PR00237. GPCRRHODOPSN. PR00428. PROSTAGLNDNR. PR01788. PROSTANOIDR. PR00584. PRSTNOIDE32R. PR00582. PRSTNOIDEP3R. |
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. False negative. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P43115. |
| ChEMBL | CHEMBL3710. |
| DrugBank | DB00905. Bimatoprost. |
| GenomeRNAi | 5733. |
| NextBio | 22302. |
| SOURCE | Search... |
Entry information
| Entry name | PE2R3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P43115 Secondary accession number(s): B0AZN4 Q16546 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
