P43088 (PF2R_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Prostaglandin F2-alpha receptor Short name=PGF receptor Short name=PGF2-alpha receptor Alternative name(s): Prostanoid FP receptor | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 359 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Receptor for prostaglandin F2-alpha (PGF2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum By similarity. |
| Subcellular location | |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | parturition Traceable author statement. Source: ProtInc |
| Cellular component | extracellular region Inferred from direct assay. Source: MGI integral to plasma membraneTraceable author statement. Source: ProtInc |
| Molecular function | prostaglandin F receptor activity Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P43088-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P43088-2) Also known as: FP(S); The sequence of this isoform differs from the canonical sequence as follows: 267-359: VTMANIGING...SPVAEKSAST → GYRIILNGKEKYKVYEEQSDFLHRLQWPTLE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 359 | 359 | Prostaglandin F2-alpha receptor | PRO_0000070070 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 31 | 31 | Extracellular Potential | ||||||||
| Transmembrane | 32 – 54 | 23 | Helical; Name=1; Potential | ||||||||
| Topological domain | 55 – 69 | 15 | Cytoplasmic Potential | ||||||||
| Transmembrane | 70 – 90 | 21 | Helical; Name=2; Potential | ||||||||
| Topological domain | 91 – 109 | 19 | Extracellular Potential | ||||||||
| Transmembrane | 110 – 131 | 22 | Helical; Name=3; Potential | ||||||||
| Topological domain | 132 – 152 | 21 | Cytoplasmic Potential | ||||||||
| Transmembrane | 153 – 175 | 23 | Helical; Name=4; Potential | ||||||||
| Topological domain | 176 – 198 | 23 | Extracellular Potential | ||||||||
| Transmembrane | 199 – 224 | 26 | Helical; Name=5; Potential | ||||||||
| Topological domain | 225 – 250 | 26 | Cytoplasmic Potential | ||||||||
| Transmembrane | 251 – 267 | 17 | Helical; Name=6; Potential | ||||||||
| Topological domain | 268 – 285 | 18 | Extracellular Potential | ||||||||
| Transmembrane | 286 – 307 | 22 | Helical; Name=7; Potential | ||||||||
| Topological domain | 308 – 359 | 52 | Cytoplasmic Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 4 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 19 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 108 ↔ 186 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 267 – 359 | 93 | VTMAN…KSAST → GYRIILNGKEKYKVYEEQSD FLHRLQWPTLE in isoform 2. | VSP_042025 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression of a cDNA for the human prostanoid FP receptor." Abramovitz M., Boie Y., Nguyen T., Rushmore T.H., Bayne M.A., Metters K.M., Slipetz D.M., Grygorczyk R. J. Biol. Chem. 269:2632-2636(1994) [PubMed: 8300593] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Uterus. |
| [2] | "Functional characterization of the ocular prostaglandin f2alpha (PGF2alpha) receptor. Activation by the isoprostane, 12-iso-PGF2alpha." Kunapuli P., Lawson J.A., Rokach J., FitzGerald G.A. J. Biol. Chem. 272:27147-27154(1997) [PubMed: 9341156] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Ocular ciliary body. |
| [3] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Kopatz S.A., Aronstam R.S., Sharma S.V. Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [4] | "Cloning and localization of hFP(S): a six-transmembrane mRNA splice variant of the human FP prostanoid receptor." Vielhauer G.A., Fujino H., Regan J.W. Arch. Biochem. Biophys. 421:175-185(2004) [PubMed: 14984197] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Trachea. |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [9] | "Structure of human prostaglandin F2alpha receptor gene." Nishizawa M., Ito S. Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-266. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L24470 mRNA. Translation: AAA17684.1. AF004021 mRNA. Translation: AAB63152.1. AY337000 mRNA. Translation: AAQ76788.1. AY485530 mRNA. Translation: AAR84381.1. AK292845 mRNA. Translation: BAF85534.1. AC096531 Genomic DNA. No translation available. AL158841 Genomic DNA. No translation available. AL136324 Genomic DNA. Translation: CAC36038.1. AL136324 Genomic DNA. Translation: CAI23426.1. CH471059 Genomic DNA. Translation: EAX06351.1. BC112965 mRNA. Translation: AAI12966.1. AB041713 Genomic DNA. Translation: BAA94756.1. |
| IPI | IPI00015730. |
| PIR | A49973. |
| RefSeq | NP_000950.1. NM_000959.3. NP_001034674.1. NM_001039585.1. |
| UniGene | Hs.654365. |
3D structure databases | |
| ProteinModelPortal | P43088. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P43088. |
Protein family/group databases | |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | P43088. |
Polymorphism databases | |
| DMDM | 1172442. |
Proteomic databases | |
| PRIDE | P43088. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000370757; ENSP00000359793; ENSG00000122420. ENST00000370758; ENSP00000359794; ENSG00000122420. |
| GeneID | 5737. |
| KEGG | hsa:5737. |
| UCSC | uc001din.1. human. |
Organism-specific databases | |
| CTD | 5737. |
| GeneCards | GC01P078729. |
| H-InvDB | HIX0023521. |
| HGNC | HGNC:9600. PTGFR. |
| MIM | 600563. gene. |
| neXtProt | NX_P43088. |
| PharmGKB | PA290. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG06020. |
| HOGENOM | HBG446637. |
| HOVERGEN | HBG003621. |
| InParanoid | P43088. |
| OMA | FSIIFMT. |
| OrthoDB | EOG4VT5Z7. |
| PhylomeDB | P43088. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | P43088. |
| Bgee | P43088. |
| CleanEx | HS_PTGFR. |
| Genevestigator | P43088. |
| GermOnline | ENSG00000122420. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000276. 7TM_GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_supfam. IPR000141. PglndnF_rcpt. IPR008365. Prostanoid_rcpt. [Graphical view] |
| KO | K04262. |
| PANTHER | PTHR11866:SF4. PglndnF_rcpt. 1 hit. PTHR11866. Prostanoid_rcpt. 1 hit. |
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] |
| PRINTS | PR00237. GPCRRHODOPSN. PR01788. PROSTANOIDR. PR00855. PRSTNOIDFPR. |
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. 1 hit. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00905. Bimatoprost. DB00654. Latanoprost. DB00287. Travoprost. |
| NextBio | 22330. |
| SOURCE | Search... |
Entry information
| Entry name | PF2R_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P43088 Secondary accession number(s): A8K9Y0 Q9P1X4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with