Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P43088

- PF2R_HUMAN

UniProt

P43088 - PF2R_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Prostaglandin F2-alpha receptor

Gene

PTGFR

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Receptor for prostaglandin F2-alpha (PGF2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum (By similarity). Isoforms 2 to 7 do not bind PGF2-alpha but are proposed to modulate signaling by participating in variant receptor complexes; heterodimers between isoform 1 and isoform 5 are proposed to be a receptor for prostamides including the synthetic analog bimatoprost.By similarity1 Publication

GO - Molecular functioni

  1. prostaglandin F receptor activity Source: UniProtKB

GO - Biological processi

  1. calcium-mediated signaling using intracellular calcium source Source: UniProtKB
  2. G-protein coupled receptor signaling pathway Source: ProtInc
  3. negative regulation of apoptotic process Source: Ensembl
  4. parturition Source: ProtInc
  5. response to lipopolysaccharide Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiREACT_18283. G alpha (q) signalling events.
REACT_18425. Prostanoid ligand receptors.

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin F2-alpha receptor
Short name:
PGF receptor
Short name:
PGF2-alpha receptor
Alternative name(s):
Prostanoid FP receptor
Gene namesi
Name:PTGFR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:9600. PTGFR.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3131ExtracellularSequence AnalysisAdd
BLAST
Transmembranei32 – 5423Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini55 – 6915CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei70 – 9021Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini91 – 10919ExtracellularSequence AnalysisAdd
BLAST
Transmembranei110 – 13122Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini132 – 15221CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei153 – 17523Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini176 – 19823ExtracellularSequence AnalysisAdd
BLAST
Transmembranei199 – 22426Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini225 – 25026CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei251 – 26717Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini268 – 28518ExtracellularSequence AnalysisAdd
BLAST
Transmembranei286 – 30722Helical; Name=7Sequence AnalysisAdd
BLAST
Topological domaini308 – 35952CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. extracellular region Source: MGI
  3. integral component of plasma membrane Source: ProtInc
  4. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA290.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 359359Prostaglandin F2-alpha receptorPRO_0000070070Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi4 – 41N-linked (GlcNAc...)Sequence Analysis
Glycosylationi19 – 191N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi108 ↔ 186PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP43088.
PRIDEiP43088.

PTM databases

PhosphoSiteiP43088.

Expressioni

Tissue specificityi

Eye.1 Publication

Gene expression databases

BgeeiP43088.
CleanExiHS_PTGFR.
ExpressionAtlasiP43088. baseline and differential.
GenevestigatoriP43088.

Interactioni

Subunit structurei

Isoform 1 can form heterodimers with isoform 5 (and probably other isoforms).1 Publication

Protein-protein interaction databases

BioGridi111709. 12 interactions.
STRINGi9606.ENSP00000359793.

Structurei

3D structure databases

ProteinModelPortaliP43088.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG263696.
GeneTreeiENSGT00760000119188.
HOGENOMiHOG000015238.
HOVERGENiHBG003621.
InParanoidiP43088.
KOiK04262.
OMAiQGRSHHF.
OrthoDBiEOG7PP575.
PhylomeDBiP43088.
TreeFamiTF324982.

Family and domain databases

Gene3Di1.20.1070.10. 1 hit.
InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR000141. PglndnF_rcpt.
IPR008365. Prostanoid_rcpt.
[Graphical view]
PANTHERiPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF4. PTHR11866:SF4. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR01788. PROSTANOIDR.
PR00855. PRSTNOIDFPR.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P43088-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSMNNSKQLV SPAAALLSNT TCQTENRLSV FFSVIFMTVG ILSNSLAIAI
60 70 80 90 100
LMKAYQRFRQ KSKASFLLLA SGLVITDFFG HLINGAIAVF VYASDKEWIR
110 120 130 140 150
FDQSNVLCSI FGICMVFSGL CPLLLGSVMA IERCIGVTKP IFHSTKITSK
160 170 180 190 200
HVKMMLSGVC LFAVFIALLP ILGHRDYKIQ ASRTWCFYNT EDIKDWEDRF
210 220 230 240 250
YLLLFSFLGL LALGVSLLCN AITGITLLRV KFKSQQHRQG RSHHLEMVIQ
260 270 280 290 300
LLAIMCVSCI CWSPFLVTMA NIGINGNHSL ETCETTLFAL RMATWNQILD
310 320 330 340 350
PWVYILLRKA VLKNLYKLAS QCCGVHVISL HIWELSSIKN SLKVAAISES

PVAEKSAST
Length:359
Mass (Da):40,055
Last modified:November 1, 1995 - v1
Checksum:i08077045C0B20BCA
GO
Isoform 2 (identifier: P43088-2) [UniParc]FASTAAdd to Basket

Also known as: FP(S), VAR-1

The sequence of this isoform differs from the canonical sequence as follows:
     267-359: VTMANIGING...SPVAEKSAST → GYRIILNGKEKYKVYEEQSDFLHRLQWPTLE

Show »
Length:297
Mass (Da):33,653
Checksum:i1D8C7CF32EE59529
GO
Isoform 3 (identifier: P43088-3) [UniParc]FASTAAdd to Basket

Also known as: VAR-2

The sequence of this isoform differs from the canonical sequence as follows:
     267-275: VTMANIGIN → KIEGKIKVT
     276-359: Missing.

Show »
Length:275
Mass (Da):30,814
Checksum:i7FB54BA16E7CD983
GO
Isoform 4 (identifier: P43088-4) [UniParc]FASTAAdd to Basket

Also known as: VAR-3

The sequence of this isoform differs from the canonical sequence as follows:
     267-291: VTMANIGINGNHSLETCETTLFALR → GYRIILNGKEKYKVYEEQSDFLHRK
     292-359: Missing.

Show »
Length:291
Mass (Da):32,913
Checksum:i41395134EB1B0802
GO
Isoform 5 (identifier: P43088-5) [UniParc]FASTAAdd to Basket

Also known as: altFP4, VAR-4

The sequence of this isoform differs from the canonical sequence as follows:
     268-296: TMANIGINGNHSLETCETTLFALRMATWN → KETHLQMRLWTWDFRVNALEDYCEGLTVF
     297-359: Missing.

Show »
Length:296
Mass (Da):33,500
Checksum:i449FB52BF889E7E2
GO
Isoform 6 (identifier: P43088-6) [UniParc]FASTAAdd to Basket

Also known as: VAR-5

The sequence of this isoform differs from the canonical sequence as follows:
     267-267: V → R
     268-359: Missing.

Show »
Length:267
Mass (Da):29,973
Checksum:iFD9F12B730760373
GO
Isoform 7 (identifier: P43088-7) [UniParc]FASTAAdd to Basket

Also known as: VAR-6

The sequence of this isoform differs from the canonical sequence as follows:
     267-274: VTMANIGI → THWGKEIP
     275-359: Missing.

Show »
Length:274
Mass (Da):30,766
Checksum:i53E8CA2E7CC1E2A8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei267 – 35993VTMAN…KSAST → GYRIILNGKEKYKVYEEQSD FLHRLQWPTLE in isoform 2. 1 PublicationVSP_042025Add
BLAST
Alternative sequencei267 – 29125VTMAN…LFALR → GYRIILNGKEKYKVYEEQSD FLHRK in isoform 4. CuratedVSP_053588Add
BLAST
Alternative sequencei267 – 2759VTMANIGIN → KIEGKIKVT in isoform 3. CuratedVSP_053589
Alternative sequencei267 – 2748VTMANIGI → THWGKEIP in isoform 7. CuratedVSP_053590
Alternative sequencei267 – 2671V → R in isoform 6. CuratedVSP_053591
Alternative sequencei268 – 35992Missing in isoform 6. CuratedVSP_053592Add
BLAST
Alternative sequencei268 – 29629TMANI…MATWN → KETHLQMRLWTWDFRVNALE DYCEGLTVF in isoform 5. CuratedVSP_053593Add
BLAST
Alternative sequencei275 – 35985Missing in isoform 7. CuratedVSP_053594Add
BLAST
Alternative sequencei276 – 35984Missing in isoform 3. CuratedVSP_053595Add
BLAST
Alternative sequencei292 – 35968Missing in isoform 4. CuratedVSP_053596Add
BLAST
Alternative sequencei297 – 35963Missing in isoform 5. CuratedVSP_053597Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L24470 mRNA. Translation: AAA17684.1.
AF004021 mRNA. Translation: AAB63152.1.
AY337000 mRNA. Translation: AAQ76788.1.
AY485530 mRNA. Translation: AAR84381.1.
AK292845 mRNA. Translation: BAF85534.1.
AC096531 Genomic DNA. No translation available.
AL158841 Genomic DNA. No translation available.
AL136324 Genomic DNA. Translation: CAC36038.1.
AL136324 Genomic DNA. Translation: CAI23426.1.
CH471059 Genomic DNA. Translation: EAX06351.1.
BC112965 mRNA. Translation: AAI12966.1.
AB041713 Genomic DNA. Translation: BAA94756.1.
CCDSiCCDS30759.1. [P43088-2]
CCDS686.1. [P43088-1]
PIRiA49973.
RefSeqiNP_000950.1. NM_000959.3. [P43088-1]
NP_001034674.1. NM_001039585.1. [P43088-2]
XP_006710844.1. XM_006710781.1. [P43088-1]
UniGeneiHs.654365.

Genome annotation databases

EnsembliENST00000370756; ENSP00000359792; ENSG00000122420. [P43088-2]
ENST00000370757; ENSP00000359793; ENSG00000122420. [P43088-1]
ENST00000370758; ENSP00000359794; ENSG00000122420. [P43088-1]
GeneIDi5737.
KEGGihsa:5737.
UCSCiuc001dim.3. human. [P43088-2]
uc001din.3. human. [P43088-1]

Polymorphism databases

DMDMi1172442.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L24470 mRNA. Translation: AAA17684.1 .
AF004021 mRNA. Translation: AAB63152.1 .
AY337000 mRNA. Translation: AAQ76788.1 .
AY485530 mRNA. Translation: AAR84381.1 .
AK292845 mRNA. Translation: BAF85534.1 .
AC096531 Genomic DNA. No translation available.
AL158841 Genomic DNA. No translation available.
AL136324 Genomic DNA. Translation: CAC36038.1 .
AL136324 Genomic DNA. Translation: CAI23426.1 .
CH471059 Genomic DNA. Translation: EAX06351.1 .
BC112965 mRNA. Translation: AAI12966.1 .
AB041713 Genomic DNA. Translation: BAA94756.1 .
CCDSi CCDS30759.1. [P43088-2 ]
CCDS686.1. [P43088-1 ]
PIRi A49973.
RefSeqi NP_000950.1. NM_000959.3. [P43088-1 ]
NP_001034674.1. NM_001039585.1. [P43088-2 ]
XP_006710844.1. XM_006710781.1. [P43088-1 ]
UniGenei Hs.654365.

3D structure databases

ProteinModelPortali P43088.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111709. 12 interactions.
STRINGi 9606.ENSP00000359793.

Chemistry

BindingDBi P43088.
ChEMBLi CHEMBL1987.
DrugBanki DB00905. Bimatoprost.
DB01160. Dinoprost Tromethamine.
DB00654. Latanoprost.
DB08819. Tafluprost.
DB00287. Travoprost.
GuidetoPHARMACOLOGYi 344.

Protein family/group databases

GPCRDBi Search...

PTM databases

PhosphoSitei P43088.

Polymorphism databases

DMDMi 1172442.

Proteomic databases

PaxDbi P43088.
PRIDEi P43088.

Protocols and materials databases

DNASUi 5737.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000370756 ; ENSP00000359792 ; ENSG00000122420 . [P43088-2 ]
ENST00000370757 ; ENSP00000359793 ; ENSG00000122420 . [P43088-1 ]
ENST00000370758 ; ENSP00000359794 ; ENSG00000122420 . [P43088-1 ]
GeneIDi 5737.
KEGGi hsa:5737.
UCSCi uc001dim.3. human. [P43088-2 ]
uc001din.3. human. [P43088-1 ]

Organism-specific databases

CTDi 5737.
GeneCardsi GC01P078729.
HGNCi HGNC:9600. PTGFR.
MIMi 600563. gene.
neXtProti NX_P43088.
PharmGKBi PA290.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG263696.
GeneTreei ENSGT00760000119188.
HOGENOMi HOG000015238.
HOVERGENi HBG003621.
InParanoidi P43088.
KOi K04262.
OMAi QGRSHHF.
OrthoDBi EOG7PP575.
PhylomeDBi P43088.
TreeFami TF324982.

Enzyme and pathway databases

Reactomei REACT_18283. G alpha (q) signalling events.
REACT_18425. Prostanoid ligand receptors.

Miscellaneous databases

GeneWikii Prostaglandin_F_receptor.
GenomeRNAii 5737.
NextBioi 22330.
PROi P43088.
SOURCEi Search...

Gene expression databases

Bgeei P43088.
CleanExi HS_PTGFR.
ExpressionAtlasi P43088. baseline and differential.
Genevestigatori P43088.

Family and domain databases

Gene3Di 1.20.1070.10. 1 hit.
InterProi IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR000141. PglndnF_rcpt.
IPR008365. Prostanoid_rcpt.
[Graphical view ]
PANTHERi PTHR11866. PTHR11866. 1 hit.
PTHR11866:SF4. PTHR11866:SF4. 1 hit.
Pfami PF00001. 7tm_1. 1 hit.
[Graphical view ]
PRINTSi PR00237. GPCRRHODOPSN.
PR01788. PROSTANOIDR.
PR00855. PRSTNOIDFPR.
PROSITEi PS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and expression of a cDNA for the human prostanoid FP receptor."
    Abramovitz M., Boie Y., Nguyen T., Rushmore T.H., Bayne M.A., Metters K.M., Slipetz D.M., Grygorczyk R.
    J. Biol. Chem. 269:2632-2636(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Uterus.
  2. "Functional characterization of the ocular prostaglandin f2alpha (PGF2alpha) receptor. Activation by the isoprostane, 12-iso-PGF2alpha."
    Kunapuli P., Lawson J.A., Rokach J., FitzGerald G.A.
    J. Biol. Chem. 272:27147-27154(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Ocular ciliary body.
  3. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
    Kopatz S.A., Aronstam R.S., Sharma S.V.
    Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  4. "Cloning and localization of hFP(S): a six-transmembrane mRNA splice variant of the human FP prostanoid receptor."
    Vielhauer G.A., Fujino H., Regan J.W.
    Arch. Biochem. Biophys. 421:175-185(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Trachea.
  6. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  9. "Structure of human prostaglandin F2alpha receptor gene."
    Nishizawa M., Ito S.
    Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-266.
    Tissue: Liver.
  10. "Identification and pharmacological characterization of the prostaglandin FP receptor and FP receptor variant complexes."
    Liang Y., Woodward D.F., Guzman V.M., Li C., Scott D.F., Wang J.W., Wheeler L.A., Garst M.E., Landsverk K., Sachs G., Krauss A.H., Cornell C., Martos J., Pettit S., Fliri H.
    Br. J. Pharmacol. 154:1079-1093(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING, SUBUNIT.

Entry informationi

Entry nameiPF2R_HUMAN
AccessioniPrimary (citable) accession number: P43088
Secondary accession number(s): A8K9Y0
, Q2KHP3, Q6RYQ6, Q9P1X4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: October 29, 2014
This is version 137 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3