Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostaglandin F2-alpha receptor

Gene

PTGFR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for prostaglandin F2-alpha (PGF2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum (By similarity). Isoforms 2 to 7 do not bind PGF2-alpha but are proposed to modulate signaling by participating in variant receptor complexes; heterodimers between isoform 1 and isoform 5 are proposed to be a receptor for prostamides including the synthetic analog bimatoprost.By similarity1 Publication

GO - Molecular functioni

  • prostaglandin F receptor activity Source: UniProtKB

GO - Biological processi

  • adenylate cyclase-activating G-protein coupled receptor signaling pathway Source: GO_Central
  • calcium-mediated signaling using intracellular calcium source Source: UniProtKB
  • cellular response to prostaglandin D stimulus Source: UniProtKB
  • G-protein coupled receptor signaling pathway Source: ProtInc
  • inflammatory response Source: GO_Central
  • negative regulation of apoptotic process Source: Ensembl
  • parturition Source: ProtInc
  • positive regulation of cell proliferation Source: UniProtKB
  • positive regulation of cytosolic calcium ion concentration Source: GO_Central
  • positive regulation of gene expression Source: Ensembl
  • response to estradiol Source: Ensembl
  • response to lipopolysaccharide Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:ENSG00000122420-MONOMER.
ReactomeiR-HSA-391908. Prostanoid ligand receptors.
R-HSA-416476. G alpha (q) signalling events.

Chemistry databases

SwissLipidsiSLP:000001573.

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin F2-alpha receptor
Short name:
PGF receptor
Short name:
PGF2-alpha receptor
Alternative name(s):
Prostanoid FP receptor
Gene namesi
Name:PTGFR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:9600. PTGFR.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 31ExtracellularSequence analysisAdd BLAST31
Transmembranei32 – 54Helical; Name=1Sequence analysisAdd BLAST23
Topological domaini55 – 69CytoplasmicSequence analysisAdd BLAST15
Transmembranei70 – 90Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini91 – 109ExtracellularSequence analysisAdd BLAST19
Transmembranei110 – 131Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini132 – 152CytoplasmicSequence analysisAdd BLAST21
Transmembranei153 – 175Helical; Name=4Sequence analysisAdd BLAST23
Topological domaini176 – 198ExtracellularSequence analysisAdd BLAST23
Transmembranei199 – 224Helical; Name=5Sequence analysisAdd BLAST26
Topological domaini225 – 250CytoplasmicSequence analysisAdd BLAST26
Transmembranei251 – 267Helical; Name=6Sequence analysisAdd BLAST17
Topological domaini268 – 285ExtracellularSequence analysisAdd BLAST18
Transmembranei286 – 307Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini308 – 359CytoplasmicSequence analysisAdd BLAST52

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • extracellular region Source: MGI
  • integral component of plasma membrane Source: ProtInc
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi5737.
OpenTargetsiENSG00000122420.
PharmGKBiPA290.

Chemistry databases

ChEMBLiCHEMBL1987.
DrugBankiDB00905. Bimatoprost.
DB01160. Dinoprost Tromethamine.
DB00654. Latanoprost.
DB08819. Tafluprost.
DB00287. Travoprost.
GuidetoPHARMACOLOGYi344.

Polymorphism and mutation databases

BioMutaiPTGFR.
DMDMi1172442.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000700701 – 359Prostaglandin F2-alpha receptorAdd BLAST359

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi4N-linked (GlcNAc...)Sequence analysis1
Glycosylationi19N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi108 ↔ 186PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP43088.
PRIDEiP43088.

PTM databases

iPTMnetiP43088.
PhosphoSitePlusiP43088.

Expressioni

Tissue specificityi

Eye.1 Publication

Gene expression databases

BgeeiENSG00000122420.
CleanExiHS_PTGFR.
ExpressionAtlasiP43088. baseline and differential.
GenevisibleiP43088. HS.

Organism-specific databases

HPAiCAB000006.

Interactioni

Subunit structurei

Isoform 1 can form heterodimers with isoform 5 (and probably other isoforms).1 Publication

Protein-protein interaction databases

BioGridi111709. 12 interactors.
STRINGi9606.ENSP00000359793.

Chemistry databases

BindingDBiP43088.

Structurei

3D structure databases

ProteinModelPortaliP43088.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000119188.
HOGENOMiHOG000015238.
HOVERGENiHBG003621.
InParanoidiP43088.
KOiK04262.
OMAiQGRSHHF.
OrthoDBiEOG091G0A2S.
PhylomeDBiP43088.
TreeFamiTF324982.

Family and domain databases

InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR000141. PglndnF_rcpt.
IPR008365. Prostanoid_rcpt.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR01788. PROSTANOIDR.
PR00855. PRSTNOIDFPR.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P43088-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSMNNSKQLV SPAAALLSNT TCQTENRLSV FFSVIFMTVG ILSNSLAIAI
60 70 80 90 100
LMKAYQRFRQ KSKASFLLLA SGLVITDFFG HLINGAIAVF VYASDKEWIR
110 120 130 140 150
FDQSNVLCSI FGICMVFSGL CPLLLGSVMA IERCIGVTKP IFHSTKITSK
160 170 180 190 200
HVKMMLSGVC LFAVFIALLP ILGHRDYKIQ ASRTWCFYNT EDIKDWEDRF
210 220 230 240 250
YLLLFSFLGL LALGVSLLCN AITGITLLRV KFKSQQHRQG RSHHLEMVIQ
260 270 280 290 300
LLAIMCVSCI CWSPFLVTMA NIGINGNHSL ETCETTLFAL RMATWNQILD
310 320 330 340 350
PWVYILLRKA VLKNLYKLAS QCCGVHVISL HIWELSSIKN SLKVAAISES

PVAEKSAST
Length:359
Mass (Da):40,055
Last modified:November 1, 1995 - v1
Checksum:i08077045C0B20BCA
GO
Isoform 2 (identifier: P43088-2) [UniParc]FASTAAdd to basket
Also known as: FP(S), VAR-1

The sequence of this isoform differs from the canonical sequence as follows:
     267-359: VTMANIGING...SPVAEKSAST → GYRIILNGKEKYKVYEEQSDFLHRLQWPTLE

Show »
Length:297
Mass (Da):33,653
Checksum:i1D8C7CF32EE59529
GO
Isoform 3 (identifier: P43088-3) [UniParc]FASTAAdd to basket
Also known as: VAR-2

The sequence of this isoform differs from the canonical sequence as follows:
     267-275: VTMANIGIN → KIEGKIKVT
     276-359: Missing.

Show »
Length:275
Mass (Da):30,814
Checksum:i7FB54BA16E7CD983
GO
Isoform 4 (identifier: P43088-4) [UniParc]FASTAAdd to basket
Also known as: VAR-3

The sequence of this isoform differs from the canonical sequence as follows:
     267-291: VTMANIGINGNHSLETCETTLFALR → GYRIILNGKEKYKVYEEQSDFLHRK
     292-359: Missing.

Show »
Length:291
Mass (Da):32,913
Checksum:i41395134EB1B0802
GO
Isoform 5 (identifier: P43088-5) [UniParc]FASTAAdd to basket
Also known as: altFP4, VAR-4

The sequence of this isoform differs from the canonical sequence as follows:
     268-296: TMANIGINGNHSLETCETTLFALRMATWN → KETHLQMRLWTWDFRVNALEDYCEGLTVF
     297-359: Missing.

Show »
Length:296
Mass (Da):33,500
Checksum:i449FB52BF889E7E2
GO
Isoform 6 (identifier: P43088-6) [UniParc]FASTAAdd to basket
Also known as: VAR-5

The sequence of this isoform differs from the canonical sequence as follows:
     267-267: V → R
     268-359: Missing.

Show »
Length:267
Mass (Da):29,973
Checksum:iFD9F12B730760373
GO
Isoform 7 (identifier: P43088-7) [UniParc]FASTAAdd to basket
Also known as: VAR-6

The sequence of this isoform differs from the canonical sequence as follows:
     267-274: VTMANIGI → THWGKEIP
     275-359: Missing.

Show »
Length:274
Mass (Da):30,766
Checksum:i53E8CA2E7CC1E2A8
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042025267 – 359VTMAN…KSAST → GYRIILNGKEKYKVYEEQSD FLHRLQWPTLE in isoform 2. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_053588267 – 291VTMAN…LFALR → GYRIILNGKEKYKVYEEQSD FLHRK in isoform 4. CuratedAdd BLAST25
Alternative sequenceiVSP_053589267 – 275VTMANIGIN → KIEGKIKVT in isoform 3. Curated9
Alternative sequenceiVSP_053590267 – 274VTMANIGI → THWGKEIP in isoform 7. Curated8
Alternative sequenceiVSP_053591267V → R in isoform 6. Curated1
Alternative sequenceiVSP_053592268 – 359Missing in isoform 6. CuratedAdd BLAST92
Alternative sequenceiVSP_053593268 – 296TMANI…MATWN → KETHLQMRLWTWDFRVNALE DYCEGLTVF in isoform 5. CuratedAdd BLAST29
Alternative sequenceiVSP_053594275 – 359Missing in isoform 7. CuratedAdd BLAST85
Alternative sequenceiVSP_053595276 – 359Missing in isoform 3. CuratedAdd BLAST84
Alternative sequenceiVSP_053596292 – 359Missing in isoform 4. CuratedAdd BLAST68
Alternative sequenceiVSP_053597297 – 359Missing in isoform 5. CuratedAdd BLAST63

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L24470 mRNA. Translation: AAA17684.1.
AF004021 mRNA. Translation: AAB63152.1.
AY337000 mRNA. Translation: AAQ76788.1.
AY485530 mRNA. Translation: AAR84381.1.
AK292845 mRNA. Translation: BAF85534.1.
AC096531 Genomic DNA. No translation available.
AL158841 Genomic DNA. No translation available.
AL136324 Genomic DNA. Translation: CAC36038.1.
AL136324 Genomic DNA. Translation: CAI23426.1.
CH471059 Genomic DNA. Translation: EAX06351.1.
BC112965 mRNA. Translation: AAI12966.1.
AB041713 Genomic DNA. Translation: BAA94756.1.
CCDSiCCDS30759.1. [P43088-2]
CCDS686.1. [P43088-1]
PIRiA49973.
RefSeqiNP_000950.1. NM_000959.3. [P43088-1]
NP_001034674.1. NM_001039585.1. [P43088-2]
XP_016857362.1. XM_017001873.1. [P43088-4]
UniGeneiHs.654365.

Genome annotation databases

EnsembliENST00000370756; ENSP00000359792; ENSG00000122420. [P43088-2]
ENST00000370757; ENSP00000359793; ENSG00000122420. [P43088-1]
ENST00000370758; ENSP00000359794; ENSG00000122420. [P43088-1]
GeneIDi5737.
KEGGihsa:5737.
UCSCiuc001dim.4. human. [P43088-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L24470 mRNA. Translation: AAA17684.1.
AF004021 mRNA. Translation: AAB63152.1.
AY337000 mRNA. Translation: AAQ76788.1.
AY485530 mRNA. Translation: AAR84381.1.
AK292845 mRNA. Translation: BAF85534.1.
AC096531 Genomic DNA. No translation available.
AL158841 Genomic DNA. No translation available.
AL136324 Genomic DNA. Translation: CAC36038.1.
AL136324 Genomic DNA. Translation: CAI23426.1.
CH471059 Genomic DNA. Translation: EAX06351.1.
BC112965 mRNA. Translation: AAI12966.1.
AB041713 Genomic DNA. Translation: BAA94756.1.
CCDSiCCDS30759.1. [P43088-2]
CCDS686.1. [P43088-1]
PIRiA49973.
RefSeqiNP_000950.1. NM_000959.3. [P43088-1]
NP_001034674.1. NM_001039585.1. [P43088-2]
XP_016857362.1. XM_017001873.1. [P43088-4]
UniGeneiHs.654365.

3D structure databases

ProteinModelPortaliP43088.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111709. 12 interactors.
STRINGi9606.ENSP00000359793.

Chemistry databases

BindingDBiP43088.
ChEMBLiCHEMBL1987.
DrugBankiDB00905. Bimatoprost.
DB01160. Dinoprost Tromethamine.
DB00654. Latanoprost.
DB08819. Tafluprost.
DB00287. Travoprost.
GuidetoPHARMACOLOGYi344.
SwissLipidsiSLP:000001573.

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiP43088.
PhosphoSitePlusiP43088.

Polymorphism and mutation databases

BioMutaiPTGFR.
DMDMi1172442.

Proteomic databases

PaxDbiP43088.
PRIDEiP43088.

Protocols and materials databases

DNASUi5737.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370756; ENSP00000359792; ENSG00000122420. [P43088-2]
ENST00000370757; ENSP00000359793; ENSG00000122420. [P43088-1]
ENST00000370758; ENSP00000359794; ENSG00000122420. [P43088-1]
GeneIDi5737.
KEGGihsa:5737.
UCSCiuc001dim.4. human. [P43088-1]

Organism-specific databases

CTDi5737.
DisGeNETi5737.
GeneCardsiPTGFR.
HGNCiHGNC:9600. PTGFR.
HPAiCAB000006.
MIMi600563. gene.
neXtProtiNX_P43088.
OpenTargetsiENSG00000122420.
PharmGKBiPA290.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000119188.
HOGENOMiHOG000015238.
HOVERGENiHBG003621.
InParanoidiP43088.
KOiK04262.
OMAiQGRSHHF.
OrthoDBiEOG091G0A2S.
PhylomeDBiP43088.
TreeFamiTF324982.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000122420-MONOMER.
ReactomeiR-HSA-391908. Prostanoid ligand receptors.
R-HSA-416476. G alpha (q) signalling events.

Miscellaneous databases

GeneWikiiProstaglandin_F_receptor.
GenomeRNAii5737.
PROiP43088.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000122420.
CleanExiHS_PTGFR.
ExpressionAtlasiP43088. baseline and differential.
GenevisibleiP43088. HS.

Family and domain databases

InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR000141. PglndnF_rcpt.
IPR008365. Prostanoid_rcpt.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR01788. PROSTANOIDR.
PR00855. PRSTNOIDFPR.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPF2R_HUMAN
AccessioniPrimary (citable) accession number: P43088
Secondary accession number(s): A8K9Y0
, Q2KHP3, Q6RYQ6, Q9P1X4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: November 2, 2016
This is version 151 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.