Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P43088 (PF2R_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 134. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Prostaglandin F2-alpha receptor

Short name=PGF receptor
Short name=PGF2-alpha receptor
Alternative name(s):
Prostanoid FP receptor
Gene names
Name:PTGFR
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length359 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Receptor for prostaglandin F2-alpha (PGF2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum By similarity. Isoforms 2 to 7 do not bind PGF2-alpha but are proposed to modulate signaling by participating in variant receptor complexes; heterodimers between isoform 1 and isoform 5 are proposed to be a receptor for prostamides including the synthetic analog bimatoprost. Ref.10

Subunit structure

Isoform 1 can form heterodimers with isoform 5 (and probably other isoforms). Ref.10

Subcellular location

Cell membrane; Multi-pass membrane protein.

Tissue specificity

Eye. Ref.10

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P43088-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P43088-2)

Also known as: FP(S); VAR-1;

The sequence of this isoform differs from the canonical sequence as follows:
     267-359: VTMANIGING...SPVAEKSAST → GYRIILNGKEKYKVYEEQSDFLHRLQWPTLE
Isoform 3 (identifier: P43088-3)

Also known as: VAR-2;

The sequence of this isoform differs from the canonical sequence as follows:
     267-275: VTMANIGIN → KIEGKIKVT
     276-359: Missing.
Isoform 4 (identifier: P43088-4)

Also known as: VAR-3;

The sequence of this isoform differs from the canonical sequence as follows:
     267-291: VTMANIGINGNHSLETCETTLFALR → GYRIILNGKEKYKVYEEQSDFLHRK
     292-359: Missing.
Isoform 5 (identifier: P43088-5)

Also known as: altFP4; VAR-4;

The sequence of this isoform differs from the canonical sequence as follows:
     268-296: TMANIGINGNHSLETCETTLFALRMATWN → KETHLQMRLWTWDFRVNALEDYCEGLTVF
     297-359: Missing.
Isoform 6 (identifier: P43088-6)

Also known as: VAR-5;

The sequence of this isoform differs from the canonical sequence as follows:
     267-267: V → R
     268-359: Missing.
Isoform 7 (identifier: P43088-7)

Also known as: VAR-6;

The sequence of this isoform differs from the canonical sequence as follows:
     267-274: VTMANIGI → THWGKEIP
     275-359: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 359359Prostaglandin F2-alpha receptor
PRO_0000070070

Regions

Topological domain1 – 3131Extracellular Potential
Transmembrane32 – 5423Helical; Name=1; Potential
Topological domain55 – 6915Cytoplasmic Potential
Transmembrane70 – 9021Helical; Name=2; Potential
Topological domain91 – 10919Extracellular Potential
Transmembrane110 – 13122Helical; Name=3; Potential
Topological domain132 – 15221Cytoplasmic Potential
Transmembrane153 – 17523Helical; Name=4; Potential
Topological domain176 – 19823Extracellular Potential
Transmembrane199 – 22426Helical; Name=5; Potential
Topological domain225 – 25026Cytoplasmic Potential
Transmembrane251 – 26717Helical; Name=6; Potential
Topological domain268 – 28518Extracellular Potential
Transmembrane286 – 30722Helical; Name=7; Potential
Topological domain308 – 35952Cytoplasmic Potential

Amino acid modifications

Glycosylation41N-linked (GlcNAc...) Potential
Glycosylation191N-linked (GlcNAc...) Potential
Disulfide bond108 ↔ 186 By similarity

Natural variations

Alternative sequence267 – 35993VTMAN…KSAST → GYRIILNGKEKYKVYEEQSD FLHRLQWPTLE in isoform 2.
VSP_042025
Alternative sequence267 – 29125VTMAN…LFALR → GYRIILNGKEKYKVYEEQSD FLHRK in isoform 4.
VSP_053588
Alternative sequence267 – 2759VTMANIGIN → KIEGKIKVT in isoform 3.
VSP_053589
Alternative sequence267 – 2748VTMANIGI → THWGKEIP in isoform 7.
VSP_053590
Alternative sequence2671V → R in isoform 6.
VSP_053591
Alternative sequence268 – 35992Missing in isoform 6.
VSP_053592
Alternative sequence268 – 29629TMANI…MATWN → KETHLQMRLWTWDFRVNALE DYCEGLTVF in isoform 5.
VSP_053593
Alternative sequence275 – 35985Missing in isoform 7.
VSP_053594
Alternative sequence276 – 35984Missing in isoform 3.
VSP_053595
Alternative sequence292 – 35968Missing in isoform 4.
VSP_053596
Alternative sequence297 – 35963Missing in isoform 5.
VSP_053597

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1995. Version 1.
Checksum: 08077045C0B20BCA

FASTA35940,055
        10         20         30         40         50         60 
MSMNNSKQLV SPAAALLSNT TCQTENRLSV FFSVIFMTVG ILSNSLAIAI LMKAYQRFRQ 

        70         80         90        100        110        120 
KSKASFLLLA SGLVITDFFG HLINGAIAVF VYASDKEWIR FDQSNVLCSI FGICMVFSGL 

       130        140        150        160        170        180 
CPLLLGSVMA IERCIGVTKP IFHSTKITSK HVKMMLSGVC LFAVFIALLP ILGHRDYKIQ 

       190        200        210        220        230        240 
ASRTWCFYNT EDIKDWEDRF YLLLFSFLGL LALGVSLLCN AITGITLLRV KFKSQQHRQG 

       250        260        270        280        290        300 
RSHHLEMVIQ LLAIMCVSCI CWSPFLVTMA NIGINGNHSL ETCETTLFAL RMATWNQILD 

       310        320        330        340        350 
PWVYILLRKA VLKNLYKLAS QCCGVHVISL HIWELSSIKN SLKVAAISES PVAEKSAST 

« Hide

Isoform 2 (FP(S)) (VAR-1) [UniParc].

Checksum: 1D8C7CF32EE59529
Show »

FASTA29733,653
Isoform 3 (VAR-2) [UniParc].

Checksum: 7FB54BA16E7CD983
Show »

FASTA27530,814
Isoform 4 (VAR-3) [UniParc].

Checksum: 41395134EB1B0802
Show »

FASTA29132,913
Isoform 5 (altFP4) (VAR-4) [UniParc].

Checksum: 449FB52BF889E7E2
Show »

FASTA29633,500
Isoform 6 (VAR-5) [UniParc].

Checksum: FD9F12B730760373
Show »

FASTA26729,973
Isoform 7 (VAR-6) [UniParc].

Checksum: 53E8CA2E7CC1E2A8
Show »

FASTA27430,766

References

« Hide 'large scale' references
[1]"Cloning and expression of a cDNA for the human prostanoid FP receptor."
Abramovitz M., Boie Y., Nguyen T., Rushmore T.H., Bayne M.A., Metters K.M., Slipetz D.M., Grygorczyk R.
J. Biol. Chem. 269:2632-2636(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Uterus.
[2]"Functional characterization of the ocular prostaglandin f2alpha (PGF2alpha) receptor. Activation by the isoprostane, 12-iso-PGF2alpha."
Kunapuli P., Lawson J.A., Rokach J., FitzGerald G.A.
J. Biol. Chem. 272:27147-27154(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Ocular ciliary body.
[3]"cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
Kopatz S.A., Aronstam R.S., Sharma S.V.
Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Placenta.
[4]"Cloning and localization of hFP(S): a six-transmembrane mRNA splice variant of the human FP prostanoid receptor."
Vielhauer G.A., Fujino H., Regan J.W.
Arch. Biochem. Biophys. 421:175-185(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING.
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Trachea.
[6]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[9]"Structure of human prostaglandin F2alpha receptor gene."
Nishizawa M., Ito S.
Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-266.
Tissue: Liver.
[10]"Identification and pharmacological characterization of the prostaglandin FP receptor and FP receptor variant complexes."
Liang Y., Woodward D.F., Guzman V.M., Li C., Scott D.F., Wang J.W., Wheeler L.A., Garst M.E., Landsverk K., Sachs G., Krauss A.H., Cornell C., Martos J., Pettit S., Fliri H.
Br. J. Pharmacol. 154:1079-1093(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING, SUBUNIT.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L24470 mRNA. Translation: AAA17684.1.
AF004021 mRNA. Translation: AAB63152.1.
AY337000 mRNA. Translation: AAQ76788.1.
AY485530 mRNA. Translation: AAR84381.1.
AK292845 mRNA. Translation: BAF85534.1.
AC096531 Genomic DNA. No translation available.
AL158841 Genomic DNA. No translation available.
AL136324 Genomic DNA. Translation: CAC36038.1.
AL136324 Genomic DNA. Translation: CAI23426.1.
CH471059 Genomic DNA. Translation: EAX06351.1.
BC112965 mRNA. Translation: AAI12966.1.
AB041713 Genomic DNA. Translation: BAA94756.1.
CCDSCCDS30759.1. [P43088-2]
CCDS686.1. [P43088-1]
PIRA49973.
RefSeqNP_000950.1. NM_000959.3. [P43088-1]
NP_001034674.1. NM_001039585.1. [P43088-2]
XP_006710844.1. XM_006710781.1. [P43088-1]
UniGeneHs.654365.

3D structure databases

ProteinModelPortalP43088.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid111709. 2 interactions.
STRING9606.ENSP00000359793.

Chemistry

BindingDBP43088.
ChEMBLCHEMBL1987.
DrugBankDB00905. Bimatoprost.
DB00654. Latanoprost.
DB00287. Travoprost.
GuidetoPHARMACOLOGY344.

Protein family/group databases

GPCRDBSearch...

PTM databases

PhosphoSiteP43088.

Polymorphism databases

DMDM1172442.

Proteomic databases

PaxDbP43088.
PRIDEP43088.

Protocols and materials databases

DNASU5737.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000370756; ENSP00000359792; ENSG00000122420. [P43088-2]
ENST00000370757; ENSP00000359793; ENSG00000122420. [P43088-1]
ENST00000370758; ENSP00000359794; ENSG00000122420. [P43088-1]
GeneID5737.
KEGGhsa:5737.
UCSCuc001dim.3. human. [P43088-2]
uc001din.3. human. [P43088-1]

Organism-specific databases

CTD5737.
GeneCardsGC01P078729.
HGNCHGNC:9600. PTGFR.
MIM600563. gene.
neXtProtNX_P43088.
PharmGKBPA290.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG263696.
HOGENOMHOG000015238.
HOVERGENHBG003621.
InParanoidP43088.
KOK04262.
OMAQGRSHHF.
OrthoDBEOG7PP575.
PhylomeDBP43088.
TreeFamTF324982.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

ArrayExpressP43088.
BgeeP43088.
CleanExHS_PTGFR.
GenevestigatorP43088.

Family and domain databases

Gene3D1.20.1070.10. 1 hit.
InterProIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR000141. PglndnF_rcpt.
IPR008365. Prostanoid_rcpt.
[Graphical view]
PANTHERPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF4. PTHR11866:SF4. 1 hit.
PfamPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSPR00237. GPCRRHODOPSN.
PR01788. PROSTANOIDR.
PR00855. PRSTNOIDFPR.
PROSITEPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiProstaglandin_F_receptor.
GenomeRNAi5737.
NextBio22330.
PROP43088.
SOURCESearch...

Entry information

Entry namePF2R_HUMAN
AccessionPrimary (citable) accession number: P43088
Secondary accession number(s): A8K9Y0 expand/collapse secondary AC list , Q2KHP3, Q6RYQ6, Q9P1X4
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: July 9, 2014
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries