Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P43088

- PF2R_HUMAN

UniProt

P43088 - PF2R_HUMAN

Protein

Prostaglandin F2-alpha receptor

Gene

PTGFR

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 136 (01 Oct 2014)
      Sequence version 1 (01 Nov 1995)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for prostaglandin F2-alpha (PGF2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum By similarity. Isoforms 2 to 7 do not bind PGF2-alpha but are proposed to modulate signaling by participating in variant receptor complexes; heterodimers between isoform 1 and isoform 5 are proposed to be a receptor for prostamides including the synthetic analog bimatoprost.By similarity1 Publication

    GO - Molecular functioni

    1. prostaglandin F receptor activity Source: UniProtKB

    GO - Biological processi

    1. calcium-mediated signaling using intracellular calcium source Source: UniProtKB
    2. G-protein coupled receptor signaling pathway Source: ProtInc
    3. negative regulation of apoptotic process Source: Ensembl
    4. parturition Source: ProtInc
    5. response to lipopolysaccharide Source: Ensembl

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Enzyme and pathway databases

    ReactomeiREACT_18283. G alpha (q) signalling events.
    REACT_18425. Prostanoid ligand receptors.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Prostaglandin F2-alpha receptor
    Short name:
    PGF receptor
    Short name:
    PGF2-alpha receptor
    Alternative name(s):
    Prostanoid FP receptor
    Gene namesi
    Name:PTGFR
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:9600. PTGFR.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. extracellular region Source: MGI
    3. integral component of plasma membrane Source: ProtInc
    4. plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA290.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 359359Prostaglandin F2-alpha receptorPRO_0000070070Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi4 – 41N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi19 – 191N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi108 ↔ 186PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiP43088.
    PRIDEiP43088.

    PTM databases

    PhosphoSiteiP43088.

    Expressioni

    Tissue specificityi

    Eye.1 Publication

    Gene expression databases

    ArrayExpressiP43088.
    BgeeiP43088.
    CleanExiHS_PTGFR.
    GenevestigatoriP43088.

    Interactioni

    Subunit structurei

    Isoform 1 can form heterodimers with isoform 5 (and probably other isoforms).1 Publication

    Protein-protein interaction databases

    BioGridi111709. 2 interactions.
    STRINGi9606.ENSP00000359793.

    Structurei

    3D structure databases

    ProteinModelPortaliP43088.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3131ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini55 – 6915CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini91 – 10919ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini132 – 15221CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini176 – 19823ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini225 – 25026CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini268 – 28518ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini308 – 35952CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei32 – 5423Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei70 – 9021Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei110 – 13122Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei153 – 17523Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei199 – 22426Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei251 – 26717Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei286 – 30722Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG263696.
    HOGENOMiHOG000015238.
    HOVERGENiHBG003621.
    InParanoidiP43088.
    KOiK04262.
    OMAiQGRSHHF.
    OrthoDBiEOG7PP575.
    PhylomeDBiP43088.
    TreeFamiTF324982.

    Family and domain databases

    Gene3Di1.20.1070.10. 1 hit.
    InterProiIPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    IPR000141. PglndnF_rcpt.
    IPR008365. Prostanoid_rcpt.
    [Graphical view]
    PANTHERiPTHR11866. PTHR11866. 1 hit.
    PTHR11866:SF4. PTHR11866:SF4. 1 hit.
    PfamiPF00001. 7tm_1. 1 hit.
    [Graphical view]
    PRINTSiPR00237. GPCRRHODOPSN.
    PR01788. PROSTANOIDR.
    PR00855. PRSTNOIDFPR.
    PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
    PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P43088-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSMNNSKQLV SPAAALLSNT TCQTENRLSV FFSVIFMTVG ILSNSLAIAI    50
    LMKAYQRFRQ KSKASFLLLA SGLVITDFFG HLINGAIAVF VYASDKEWIR 100
    FDQSNVLCSI FGICMVFSGL CPLLLGSVMA IERCIGVTKP IFHSTKITSK 150
    HVKMMLSGVC LFAVFIALLP ILGHRDYKIQ ASRTWCFYNT EDIKDWEDRF 200
    YLLLFSFLGL LALGVSLLCN AITGITLLRV KFKSQQHRQG RSHHLEMVIQ 250
    LLAIMCVSCI CWSPFLVTMA NIGINGNHSL ETCETTLFAL RMATWNQILD 300
    PWVYILLRKA VLKNLYKLAS QCCGVHVISL HIWELSSIKN SLKVAAISES 350
    PVAEKSAST 359
    Length:359
    Mass (Da):40,055
    Last modified:November 1, 1995 - v1
    Checksum:i08077045C0B20BCA
    GO
    Isoform 2 (identifier: P43088-2) [UniParc]FASTAAdd to Basket

    Also known as: FP(S), VAR-1

    The sequence of this isoform differs from the canonical sequence as follows:
         267-359: VTMANIGING...SPVAEKSAST → GYRIILNGKEKYKVYEEQSDFLHRLQWPTLE

    Show »
    Length:297
    Mass (Da):33,653
    Checksum:i1D8C7CF32EE59529
    GO
    Isoform 3 (identifier: P43088-3) [UniParc]FASTAAdd to Basket

    Also known as: VAR-2

    The sequence of this isoform differs from the canonical sequence as follows:
         267-275: VTMANIGIN → KIEGKIKVT
         276-359: Missing.

    Show »
    Length:275
    Mass (Da):30,814
    Checksum:i7FB54BA16E7CD983
    GO
    Isoform 4 (identifier: P43088-4) [UniParc]FASTAAdd to Basket

    Also known as: VAR-3

    The sequence of this isoform differs from the canonical sequence as follows:
         267-291: VTMANIGINGNHSLETCETTLFALR → GYRIILNGKEKYKVYEEQSDFLHRK
         292-359: Missing.

    Show »
    Length:291
    Mass (Da):32,913
    Checksum:i41395134EB1B0802
    GO
    Isoform 5 (identifier: P43088-5) [UniParc]FASTAAdd to Basket

    Also known as: altFP4, VAR-4

    The sequence of this isoform differs from the canonical sequence as follows:
         268-296: TMANIGINGNHSLETCETTLFALRMATWN → KETHLQMRLWTWDFRVNALEDYCEGLTVF
         297-359: Missing.

    Show »
    Length:296
    Mass (Da):33,500
    Checksum:i449FB52BF889E7E2
    GO
    Isoform 6 (identifier: P43088-6) [UniParc]FASTAAdd to Basket

    Also known as: VAR-5

    The sequence of this isoform differs from the canonical sequence as follows:
         267-267: V → R
         268-359: Missing.

    Show »
    Length:267
    Mass (Da):29,973
    Checksum:iFD9F12B730760373
    GO
    Isoform 7 (identifier: P43088-7) [UniParc]FASTAAdd to Basket

    Also known as: VAR-6

    The sequence of this isoform differs from the canonical sequence as follows:
         267-274: VTMANIGI → THWGKEIP
         275-359: Missing.

    Show »
    Length:274
    Mass (Da):30,766
    Checksum:i53E8CA2E7CC1E2A8
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei267 – 35993VTMAN…KSAST → GYRIILNGKEKYKVYEEQSD FLHRLQWPTLE in isoform 2. 1 PublicationVSP_042025Add
    BLAST
    Alternative sequencei267 – 29125VTMAN…LFALR → GYRIILNGKEKYKVYEEQSD FLHRK in isoform 4. CuratedVSP_053588Add
    BLAST
    Alternative sequencei267 – 2759VTMANIGIN → KIEGKIKVT in isoform 3. CuratedVSP_053589
    Alternative sequencei267 – 2748VTMANIGI → THWGKEIP in isoform 7. CuratedVSP_053590
    Alternative sequencei267 – 2671V → R in isoform 6. CuratedVSP_053591
    Alternative sequencei268 – 35992Missing in isoform 6. CuratedVSP_053592Add
    BLAST
    Alternative sequencei268 – 29629TMANI…MATWN → KETHLQMRLWTWDFRVNALE DYCEGLTVF in isoform 5. CuratedVSP_053593Add
    BLAST
    Alternative sequencei275 – 35985Missing in isoform 7. CuratedVSP_053594Add
    BLAST
    Alternative sequencei276 – 35984Missing in isoform 3. CuratedVSP_053595Add
    BLAST
    Alternative sequencei292 – 35968Missing in isoform 4. CuratedVSP_053596Add
    BLAST
    Alternative sequencei297 – 35963Missing in isoform 5. CuratedVSP_053597Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L24470 mRNA. Translation: AAA17684.1.
    AF004021 mRNA. Translation: AAB63152.1.
    AY337000 mRNA. Translation: AAQ76788.1.
    AY485530 mRNA. Translation: AAR84381.1.
    AK292845 mRNA. Translation: BAF85534.1.
    AC096531 Genomic DNA. No translation available.
    AL158841 Genomic DNA. No translation available.
    AL136324 Genomic DNA. Translation: CAC36038.1.
    AL136324 Genomic DNA. Translation: CAI23426.1.
    CH471059 Genomic DNA. Translation: EAX06351.1.
    BC112965 mRNA. Translation: AAI12966.1.
    AB041713 Genomic DNA. Translation: BAA94756.1.
    CCDSiCCDS30759.1. [P43088-2]
    CCDS686.1. [P43088-1]
    PIRiA49973.
    RefSeqiNP_000950.1. NM_000959.3. [P43088-1]
    NP_001034674.1. NM_001039585.1. [P43088-2]
    XP_006710844.1. XM_006710781.1. [P43088-1]
    UniGeneiHs.654365.

    Genome annotation databases

    EnsembliENST00000370756; ENSP00000359792; ENSG00000122420. [P43088-2]
    ENST00000370757; ENSP00000359793; ENSG00000122420. [P43088-1]
    ENST00000370758; ENSP00000359794; ENSG00000122420. [P43088-1]
    GeneIDi5737.
    KEGGihsa:5737.
    UCSCiuc001dim.3. human. [P43088-2]
    uc001din.3. human. [P43088-1]

    Polymorphism databases

    DMDMi1172442.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L24470 mRNA. Translation: AAA17684.1 .
    AF004021 mRNA. Translation: AAB63152.1 .
    AY337000 mRNA. Translation: AAQ76788.1 .
    AY485530 mRNA. Translation: AAR84381.1 .
    AK292845 mRNA. Translation: BAF85534.1 .
    AC096531 Genomic DNA. No translation available.
    AL158841 Genomic DNA. No translation available.
    AL136324 Genomic DNA. Translation: CAC36038.1 .
    AL136324 Genomic DNA. Translation: CAI23426.1 .
    CH471059 Genomic DNA. Translation: EAX06351.1 .
    BC112965 mRNA. Translation: AAI12966.1 .
    AB041713 Genomic DNA. Translation: BAA94756.1 .
    CCDSi CCDS30759.1. [P43088-2 ]
    CCDS686.1. [P43088-1 ]
    PIRi A49973.
    RefSeqi NP_000950.1. NM_000959.3. [P43088-1 ]
    NP_001034674.1. NM_001039585.1. [P43088-2 ]
    XP_006710844.1. XM_006710781.1. [P43088-1 ]
    UniGenei Hs.654365.

    3D structure databases

    ProteinModelPortali P43088.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111709. 2 interactions.
    STRINGi 9606.ENSP00000359793.

    Chemistry

    BindingDBi P43088.
    ChEMBLi CHEMBL1987.
    DrugBanki DB00905. Bimatoprost.
    DB00654. Latanoprost.
    DB00287. Travoprost.
    GuidetoPHARMACOLOGYi 344.

    Protein family/group databases

    GPCRDBi Search...

    PTM databases

    PhosphoSitei P43088.

    Polymorphism databases

    DMDMi 1172442.

    Proteomic databases

    PaxDbi P43088.
    PRIDEi P43088.

    Protocols and materials databases

    DNASUi 5737.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000370756 ; ENSP00000359792 ; ENSG00000122420 . [P43088-2 ]
    ENST00000370757 ; ENSP00000359793 ; ENSG00000122420 . [P43088-1 ]
    ENST00000370758 ; ENSP00000359794 ; ENSG00000122420 . [P43088-1 ]
    GeneIDi 5737.
    KEGGi hsa:5737.
    UCSCi uc001dim.3. human. [P43088-2 ]
    uc001din.3. human. [P43088-1 ]

    Organism-specific databases

    CTDi 5737.
    GeneCardsi GC01P078729.
    HGNCi HGNC:9600. PTGFR.
    MIMi 600563. gene.
    neXtProti NX_P43088.
    PharmGKBi PA290.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG263696.
    HOGENOMi HOG000015238.
    HOVERGENi HBG003621.
    InParanoidi P43088.
    KOi K04262.
    OMAi QGRSHHF.
    OrthoDBi EOG7PP575.
    PhylomeDBi P43088.
    TreeFami TF324982.

    Enzyme and pathway databases

    Reactomei REACT_18283. G alpha (q) signalling events.
    REACT_18425. Prostanoid ligand receptors.

    Miscellaneous databases

    GeneWikii Prostaglandin_F_receptor.
    GenomeRNAii 5737.
    NextBioi 22330.
    PROi P43088.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P43088.
    Bgeei P43088.
    CleanExi HS_PTGFR.
    Genevestigatori P43088.

    Family and domain databases

    Gene3Di 1.20.1070.10. 1 hit.
    InterProi IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    IPR000141. PglndnF_rcpt.
    IPR008365. Prostanoid_rcpt.
    [Graphical view ]
    PANTHERi PTHR11866. PTHR11866. 1 hit.
    PTHR11866:SF4. PTHR11866:SF4. 1 hit.
    Pfami PF00001. 7tm_1. 1 hit.
    [Graphical view ]
    PRINTSi PR00237. GPCRRHODOPSN.
    PR01788. PROSTANOIDR.
    PR00855. PRSTNOIDFPR.
    PROSITEi PS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
    PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and expression of a cDNA for the human prostanoid FP receptor."
      Abramovitz M., Boie Y., Nguyen T., Rushmore T.H., Bayne M.A., Metters K.M., Slipetz D.M., Grygorczyk R.
      J. Biol. Chem. 269:2632-2636(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Uterus.
    2. "Functional characterization of the ocular prostaglandin f2alpha (PGF2alpha) receptor. Activation by the isoprostane, 12-iso-PGF2alpha."
      Kunapuli P., Lawson J.A., Rokach J., FitzGerald G.A.
      J. Biol. Chem. 272:27147-27154(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Ocular ciliary body.
    3. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
      Kopatz S.A., Aronstam R.S., Sharma S.V.
      Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.
    4. "Cloning and localization of hFP(S): a six-transmembrane mRNA splice variant of the human FP prostanoid receptor."
      Vielhauer G.A., Fujino H., Regan J.W.
      Arch. Biochem. Biophys. 421:175-185(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING.
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Trachea.
    6. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    9. "Structure of human prostaglandin F2alpha receptor gene."
      Nishizawa M., Ito S.
      Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-266.
      Tissue: Liver.
    10. "Identification and pharmacological characterization of the prostaglandin FP receptor and FP receptor variant complexes."
      Liang Y., Woodward D.F., Guzman V.M., Li C., Scott D.F., Wang J.W., Wheeler L.A., Garst M.E., Landsverk K., Sachs G., Krauss A.H., Cornell C., Martos J., Pettit S., Fliri H.
      Br. J. Pharmacol. 154:1079-1093(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING, SUBUNIT.

    Entry informationi

    Entry nameiPF2R_HUMAN
    AccessioniPrimary (citable) accession number: P43088
    Secondary accession number(s): A8K9Y0
    , Q2KHP3, Q6RYQ6, Q9P1X4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1995
    Last sequence update: November 1, 1995
    Last modified: October 1, 2014
    This is version 136 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    3. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3