P43003 (EAA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 120.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Excitatory amino acid transporter 1 Alternative name(s): Sodium-dependent glutamate/aspartate transporter 1 Short name=GLAST-1 Solute carrier family 1 member 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 542 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium. |
| Subcellular location | |
| Tissue specificity | Highly expressed in cerebellum, but also found in frontal cortex, hippocampus and basal ganglia. |
| Post-translational modification | Glycosylated. |
| Involvement in disease | Episodic ataxia 6 (EA6) [MIM:612656]: A disorder characterized by episodic ataxia, seizures, migraine and alternating hemiplegia. |
| Sequence similarities | Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A3 subfamily. [View classification] |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P43003-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P43003-2) Also known as: EAAT1ex9skip; The sequence of this isoform differs from the canonical sequence as follows: 430-475: SITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFL → R | ||||||
| Note: Expressed throughout the CNS, both in gray matter and axonal tracts, at levels ranging between 10% and 20% of isoform 1. Localizes to ER, has no functional glutamate uptake activity, and exerts a dominant negative effect isoform 1. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 542 | 542 | Excitatory amino acid transporter 1 | PRO_0000202057 | |||||
Regions | |||||||||
| Topological domain | 1 – 47 | 47 | Cytoplasmic Potential | ||||||
| Transmembrane | 48 – 68 | 21 | Helical; Potential | ||||||
| Transmembrane | 91 – 111 | 21 | Helical; Potential | ||||||
| Transmembrane | 123 – 145 | 23 | Helical; Potential | ||||||
| Topological domain | 146 – 237 | 92 | Extracellular Potential | ||||||
| Transmembrane | 238 – 260 | 23 | Helical; Potential | ||||||
| Transmembrane | 281 – 302 | 22 | Helical; Potential | ||||||
| Transmembrane | 319 – 340 | 22 | Helical; Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 512 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 430 – 475 | 46 | SITAT…VDWFL → R in isoform 2. | VSP_043913 | |||||
| Natural variant | 219 | 1 | E → D. Corresponds to variant rs2032892 [ dbSNP | Ensembl ]. | VAR_011877 | |||||
| Natural variant | 290 | 1 | P → R in EA6. Ref.10 | VAR_031733 | |||||
Experimental info | |||||||||
| Sequence conflict | 366 | 1 | S → CT Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a glutamate transporter cDNA from human cerebellum." Shashidharan P., Plaitakis A. Biochim. Biophys. Acta 1216:161-164(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Cerebellum. |
| [2] | "Functional comparisons of three glutamate transporter subtypes cloned from human motor cortex." Arriza J.L., Fairman W.A., Wendy A., Wadiche J.I., Murdoch G.H., Kavanaugh M.P., Amara S.G. J. Neurosci. 14:5559-5569(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain cortex. |
| [3] | "Cloning and expression of a human glutamate transporter." Kawakami H., Tanaka K., Nakayama T., Inoue K., Nakamura S. Biochem. Biophys. Res. Commun. 199:171-176(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "Human high affinity, Na(+)-dependent L-glutamate/L-aspartate transporter GLAST-1 (EAAT-1): gene structure and localization to chromosome 5p11-p12." Stoffel W., Sasse J., Dueker M., Mueller R., Hofmann K.O., Fink T., Lichter P. FEBS Lett. 386:189-193(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "A novel alternative splicing form of excitatory amino acid transporter 1 is a negative regulator of glutamate uptake." Vallejo-Illarramendi A., Domercq M., Matute C. J. Neurochem. 95:341-348(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cerebellum. |
| [7] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [10] | "Mutation in the glutamate transporter EAAT1 causes episodic ataxia, hemiplegia, and seizures." Jen J.C., Wan J., Palos T.P., Howard B.D., Baloh R.W. Neurology 65:529-534(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT EA6 ARG-290. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L19158 mRNA. No translation available. U03504 mRNA. Translation: AAA50428.1. D26443 mRNA. Translation: BAA05462.1. Z31713 Z31710 Genomic DNA. Translation: CAA83507.1.AY954110 mRNA. Translation: AAY28724.1. AK312304 mRNA. Translation: BAG35230.1. AC008957 Genomic DNA. No translation available. AC010631 Genomic DNA. No translation available. CH471119 Genomic DNA. Translation: EAW55945.1. |
| IPI | IPI00015473. IPI00642894. |
| PIR | S38353. |
| RefSeq | NP_001160167.1. NM_001166695.1. NP_004163.3. NM_004172.4. |
| UniGene | Hs.481918. |
3D structure databases | |
| ProteinModelPortal | P43003. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-5004226. |
| STRING | 9606.ENSP00000265113. |
PTM databases | |
| PhosphoSite | P43003. |
Polymorphism databases | |
| DMDM | 1169458. |
Proteomic databases | |
| PaxDb | P43003. |
| PRIDE | P43003. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000265113; ENSP00000265113; ENSG00000079215. ENST00000381918; ENSP00000371343; ENSG00000079215. |
| GeneID | 6507. |
| KEGG | hsa:6507. |
| UCSC | uc003jkj.4. human. |
Organism-specific databases | |
| CTD | 6507. |
| GeneCards | GC05P036606. |
| HGNC | HGNC:10941. SLC1A3. |
| HPA | CAB002573. HPA037467. HPA037468. |
| MIM | 600111. gene. 612656. phenotype. |
| neXtProt | NX_P43003. |
| Orphanet | 2131. Alternating hemiplegia of childhood. 209967. Episodic ataxia type 6. |
| PharmGKB | PA35828. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1301. |
| HOGENOM | HOG000208776. |
| HOVERGEN | HBG000080. |
| InParanoid | P43003. |
| KO | K05614. |
| OMA | TLRPYRM. |
| OrthoDB | EOG46HG9R. |
| PhylomeDB | P43003. |
Enzyme and pathway databases | |
| Reactome | REACT_13685. Neuronal System. REACT_15518. Transmembrane transport of small molecules. REACT_19419. Amino acid and oligopeptide SLC transporters. |
Gene expression databases | |
| ArrayExpress | P43003. |
| Bgee | P43003. |
| CleanEx | HS_SLC1A3. |
| Genevestigator | P43003. |
| GermOnline | ENSG00000079215. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001991. Na-dicarboxylate_symporter. IPR018107. Na-dicarboxylate_symporter_CS. [Graphical view] |
| PANTHER | PTHR11958. PTHR11958. 1 hit. |
| Pfam | PF00375. SDF. 1 hit. [Graphical view] |
| PRINTS | PR00173. EDTRNSPORT. |
| PROSITE | PS00713. NA_DICARBOXYL_SYMP_1. 1 hit. PS00714. NA_DICARBOXYL_SYMP_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P43003. |
| ChEMBL | CHEMBL3085. |
| ChiTaRS | SLC1A3. human. |
| DrugBank | DB00142. L-Glutamic Acid. |
| GenomeRNAi | 6507. |
| NextBio | 25301. |
| SOURCE | Search... |
Entry information
| Entry name | EAA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P43003 Secondary accession number(s): B2R5T3, Q4JCQ8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
