Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Endothelin-converting enzyme 1

Gene

ECE1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Converts big endothelin-1 to endothelin-1.1 Publication

Catalytic activityi

Hydrolysis of the 21-Trp-|-Val-22 bond in big endothelin to form endothelin 1.

Cofactori

Zn2+1 PublicationNote: Binds 1 zinc ion per subunit.1 Publication

Enzyme regulationi

Inhibited by phosphoramidon.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi607Zinc; catalytic1
Active sitei6081
Metal bindingi611Zinc; catalytic1
Metal bindingi667Zinc; catalytic1
Active sitei671Proton donorPROSITE-ProRule annotation1

GO - Molecular functioni

  • endopeptidase activity Source: BHF-UCL
  • metal ion binding Source: UniProtKB-KW
  • metalloendopeptidase activity Source: BHF-UCL
  • peptide hormone binding Source: BHF-UCL
  • protein homodimerization activity Source: BHF-UCL

GO - Biological processi

  • bradykinin catabolic process Source: BHF-UCL
  • calcitonin catabolic process Source: BHF-UCL
  • ear development Source: BHF-UCL
  • embryonic digit morphogenesis Source: BHF-UCL
  • endothelin maturation Source: BHF-UCL
  • heart development Source: BHF-UCL
  • hormone catabolic process Source: BHF-UCL
  • peptide hormone processing Source: BHF-UCL
  • pharyngeal system development Source: Ensembl
  • positive regulation of receptor recycling Source: BHF-UCL
  • protein processing Source: BHF-UCL
  • regulation of systemic arterial blood pressure by endothelin Source: BHF-UCL
  • regulation of vasoconstriction Source: BHF-UCL
  • substance P catabolic process Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:HS04115-MONOMER.
BRENDAi3.4.24.71. 2681.

Protein family/group databases

MEROPSiM13.002.

Names & Taxonomyi

Protein namesi
Recommended name:
Endothelin-converting enzyme 1 (EC:3.4.24.71)
Short name:
ECE-1
Gene namesi
Name:ECE1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:3146. ECE1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 68CytoplasmicSequence analysisAdd BLAST68
Transmembranei69 – 89Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini90 – 770ExtracellularSequence analysisAdd BLAST681

GO - Cellular componenti

  • early endosome Source: BHF-UCL
  • endosome Source: BHF-UCL
  • external side of plasma membrane Source: BHF-UCL
  • extracellular exosome Source: UniProtKB
  • integral component of membrane Source: BHF-UCL
  • intrinsic component of endosome membrane Source: BHF-UCL
  • lysosomal membrane Source: UniProtKB
  • membrane Source: UniProtKB
  • perinuclear region of cytoplasm Source: BHF-UCL
  • plasma membrane Source: BHF-UCL
  • vesicle Source: BHF-UCL
  • Weibel-Palade body Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Hirschsprung disease cardiac defects and autonomic dysfunction (HSCRCDAD)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by skip-lesions Hirschsprung disease, craniofacial abnormalities and other dysmorphic features, cardiac defects including ductus arteriosus, small subaortic ventricular septal defect, small atrial septal defect, and autonomic dysfunction.
See also OMIM:613870
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_026747754R → C in HSCRCDAD. 1 PublicationCorresponds to variant rs3026906dbSNPEnsembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi428C → S: Abolishes dimerization. 1 Publication1

Keywords - Diseasei

Disease mutation, Hirschsprung disease

Organism-specific databases

DisGeNETi1889.
MalaCardsiECE1.
MIMi613870. phenotype.
OpenTargetsiENSG00000117298.
Orphaneti388. Hirschsprung disease.
PharmGKBiPA27594.

Chemistry databases

ChEMBLiCHEMBL4791.
GuidetoPHARMACOLOGYi1615.

Polymorphism and mutation databases

BioMutaiECE1.
DMDMi1706563.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000782201 – 770Endothelin-converting enzyme 1Add BLAST770

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei25PhosphothreonineCombined sources1
Glycosylationi166N-linked (GlcNAc...)2 Publications1
Glycosylationi187N-linked (GlcNAc...)Sequence analysis1
Glycosylationi210N-linked (GlcNAc...)3 Publications1
Glycosylationi270N-linked (GlcNAc...)1 Publication1
Glycosylationi316N-linked (GlcNAc...)1 Publication1
Glycosylationi362N-linked (GlcNAc...)1 Publication1
Glycosylationi383N-linked (GlcNAc...)1 Publication1
Disulfide bondi428Interchain
Glycosylationi539N-linked (GlcNAc...)Sequence analysis1
Glycosylationi632N-linked (GlcNAc...)Sequence analysis1
Glycosylationi651N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiP42892.
MaxQBiP42892.
PaxDbiP42892.
PeptideAtlasiP42892.
PRIDEiP42892.

PTM databases

iPTMnetiP42892.
PhosphoSitePlusiP42892.
SwissPalmiP42892.

Expressioni

Tissue specificityi

All isoforms are expressed in umbilical vein endothelial cells, polynuclear neutrophils, fibroblasts, atrium cardiomyocytes and ventricles. Isoforms A, B and C are also expressed in placenta, lung, heart, adrenal gland and phaeochromocytoma; isoforms A and C in liver, testis and small intestine; isoform B, C and D in endothelial cells and umbilical vein smooth muscle cells; isoforms C and D in saphenous vein cells, and isoform C in kidney.2 Publications

Gene expression databases

BgeeiENSG00000117298.
ExpressionAtlasiP42892. baseline and differential.
GenevisibleiP42892. HS.

Organism-specific databases

HPAiHPA001490.
HPA013616.

Interactioni

Subunit structurei

Homodimer; disulfide-linked.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CLK2P497605EBI-2859983,EBI-750020
KRTAP10-5P603703EBI-2859983,EBI-10172150

GO - Molecular functioni

  • protein homodimerization activity Source: BHF-UCL

Protein-protein interaction databases

BioGridi108218. 27 interactors.
IntActiP42892. 13 interactors.
STRINGi9606.ENSP00000364028.

Chemistry databases

BindingDBiP42892.

Structurei

Secondary structure

1770
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi102 – 114Combined sources13
Turni121 – 123Combined sources3
Helixi125 – 136Combined sources12
Beta strandi144 – 147Combined sources4
Helixi148 – 164Combined sources17
Helixi173 – 186Combined sources14
Helixi189 – 194Combined sources6
Helixi197 – 205Combined sources9
Helixi220 – 229Combined sources10
Beta strandi235 – 244Combined sources10
Beta strandi247 – 256Combined sources10
Beta strandi261 – 264Combined sources4
Helixi266 – 269Combined sources4
Turni270 – 273Combined sources4
Helixi277 – 291Combined sources15
Helixi297 – 317Combined sources21
Helixi321 – 324Combined sources4
Helixi327 – 330Combined sources4
Beta strandi332 – 335Combined sources4
Helixi336 – 342Combined sources7
Helixi348 – 355Combined sources8
Beta strandi366 – 370Combined sources5
Helixi372 – 384Combined sources13
Helixi387 – 402Combined sources16
Helixi403 – 405Combined sources3
Helixi408 – 418Combined sources11
Helixi434 – 455Combined sources22
Helixi458 – 479Combined sources22
Helixi487 – 499Combined sources13
Beta strandi501 – 506Combined sources6
Helixi508 – 511Combined sources4
Helixi513 – 520Combined sources8
Helixi530 – 546Combined sources17
Turni547 – 550Combined sources4
Beta strandi568 – 570Combined sources3
Turni571 – 574Combined sources4
Beta strandi575 – 579Combined sources5
Helixi580 – 582Combined sources3
Turni585 – 587Combined sources3
Helixi594 – 599Combined sources6
Helixi601 – 611Combined sources11
Helixi617 – 619Combined sources3
Helixi632 – 649Combined sources18
Beta strandi653 – 658Combined sources6
Turni661 – 664Combined sources4
Helixi665 – 689Combined sources25
Beta strandi696 – 698Combined sources3
Helixi702 – 713Combined sources12
Beta strandi716 – 718Combined sources3
Helixi720 – 729Combined sources10
Helixi735 – 744Combined sources10
Helixi747 – 753Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3DWBX-ray2.38A101-770[»]
ProteinModelPortaliP42892.
SMRiP42892.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP42892.

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M13 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3624. Eukaryota.
COG3590. LUCA.
GeneTreeiENSGT00760000119162.
HOGENOMiHOG000245574.
HOVERGENiHBG005554.
InParanoidiP42892.
KOiK01415.
OMAiLQVNFHS.
OrthoDBiEOG091G025Y.
PhylomeDBiP42892.
TreeFamiTF315192.

Family and domain databases

CDDicd08662. M13. 1 hit.
Gene3Di3.40.390.10. 2 hits.
InterProiIPR029734. ECE1.
IPR024079. MetalloPept_cat_dom.
IPR000718. Peptidase_M13.
IPR018497. Peptidase_M13_C.
IPR008753. Peptidase_M13_N.
[Graphical view]
PANTHERiPTHR11733. PTHR11733. 1 hit.
PTHR11733:SF130. PTHR11733:SF130. 1 hit.
PfamiPF01431. Peptidase_M13. 1 hit.
PF05649. Peptidase_M13_N. 1 hit.
[Graphical view]
PRINTSiPR00786. NEPRILYSIN.
PROSITEiPS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B (identifier: P42892-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRGVWPPPVS ALLSALGMST YKRATLDEED LVDSLSEGDA YPNGLQVNFH
60 70 80 90 100
SPRSGQRCWA ARTQVEKRLV VLVVLLAAGL VACLAALGIQ YQTRSPSVCL
110 120 130 140 150
SEACVSVTSS ILSSMDPTVD PCHDFFSYAC GGWIKANPVP DGHSRWGTFS
160 170 180 190 200
NLWEHNQAII KHLLENSTAS VSEAERKAQV YYRACMNETR IEELRAKPLM
210 220 230 240 250
ELIERLGGWN ITGPWAKDNF QDTLQVVTAH YRTSPFFSVY VSADSKNSNS
260 270 280 290 300
NVIQVDQSGL GLPSRDYYLN KTENEKVLTG YLNYMVQLGK LLGGGDEEAI
310 320 330 340 350
RPQMQQILDF ETALANITIP QEKRRDEELI YHKVTAAELQ TLAPAINWLP
360 370 380 390 400
FLNTIFYPVE INESEPIVVY DKEYLEQIST LINTTDRCLL NNYMIWNLVR
410 420 430 440 450
KTSSFLDQRF QDADEKFMEV MYGTKKTCLP RWKFCVSDTE NNLGFALGPM
460 470 480 490 500
FVKATFAEDS KSIATEIILE IKKAFEESLS TLKWMDEETR KSAKEKADAI
510 520 530 540 550
YNMIGYPNFI MDPKELDKVF NDYTAVPDLY FENAMRFFNF SWRVTADQLR
560 570 580 590 600
KAPNRDQWSM TPPMVNAYYS PTKNEIVFPA GILQAPFYTR SSPKALNFGG
610 620 630 640 650
IGVVVGHELT HAFDDQGREY DKDGNLRPWW KNSSVEAFKR QTECMVEQYS
660 670 680 690 700
NYSVNGEPVN GRHTLGENIA DNGGLKAAYR AYQNWVKKNG AEHSLPTLGL
710 720 730 740 750
TNNQLFFLGF AQVWCSVRTP ESSHEGLITD PHSPSRFRVI GSLSNSKEFS
760 770
EHFRCPPGSP MNPPHKCEVW
Length:770
Mass (Da):87,164
Last modified:October 1, 1996 - v2
Checksum:iDD88A59748B22F80
GO
Isoform A (identifier: P42892-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MRGVWPPPVS...LSEGDAYPNG → MPLQGLGLQRNPFLQGKRGPGLTSSPPLLPPS

Show »
Length:758
Mass (Da):85,808
Checksum:i4768314E789DFF96
GO
Isoform C (identifier: P42892-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MRGVWPPPVSALLSALG → M

Show »
Length:754
Mass (Da):85,562
Checksum:iA16E45032B03029D
GO
Isoform D (identifier: P42892-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MRGVWPPPVSALLSALG → MEALRESVLHLALQ

Show »
Length:767
Mass (Da):87,022
Checksum:i09B58AF5A63882F4
GO

Sequence cautioni

The sequence AAX35820 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAA84548 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_011972341T → I.1 PublicationCorresponds to variant rs1076669dbSNPEnsembl.1
Natural variantiVAR_054007630W → R.Corresponds to variant rs2229451dbSNPEnsembl.1
Natural variantiVAR_026747754R → C in HSCRCDAD. 1 PublicationCorresponds to variant rs3026906dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0055021 – 44MRGVW…AYPNG → MPLQGLGLQRNPFLQGKRGP GLTSSPPLLPPS in isoform A. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_0055041 – 17MRGVW…LSALG → M in isoform C. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_0055031 – 17MRGVW…LSALG → MEALRESVLHLALQ in isoform D. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49471 mRNA. Translation: BAA08442.1.
D43698 mRNA. Translation: BAA07800.1.
X91922
, X91923, X91924, X91925, X91926, X91927, X91928, X91929, X91930, X91931, X91932, X91933, X91934, X91935, X91936, X91937, X91938, X91939 Genomic DNA. Translation: CAA63015.1.
X91923
, X91924, X91925, X91926, X91927, X91928, X91929, X91930, X91931, X91932, X91933, X91934, X91935, X91936, X91937, X91938, X91939 Genomic DNA. Translation: CAA63016.1.
AB031742 mRNA. Translation: BAA83687.1.
AK290656 mRNA. Translation: BAF83345.1.
AK304167 mRNA. Translation: BAG65053.1.
AY953519 Genomic DNA. Translation: AAX35820.1. Sequence problems.
AL031005 Genomic DNA. Translation: CAI20195.1.
AL031005, AL031728 Genomic DNA. Translation: CAI20192.1.
AL031005, AL031728 Genomic DNA. Translation: CAI20194.1.
AL031728 Genomic DNA. Translation: CAB52285.2.
AL031728, AL031005 Genomic DNA. Translation: CAI19064.1.
CH471134 Genomic DNA. Translation: EAW94959.1.
CH471134 Genomic DNA. Translation: EAW94964.1.
BC117256 mRNA. Translation: AAI17257.1.
BC126257 mRNA. Translation: AAI26258.1.
AJ130828 mRNA. Translation: CAB46443.1.
X98272 mRNA. Translation: CAA66922.1.
Z35307 mRNA. Translation: CAA84548.1. Different initiation.
AF018034 Genomic DNA. Translation: AAD21221.1.
CCDSiCCDS215.1. [P42892-1]
CCDS44081.1. [P42892-3]
CCDS44082.1. [P42892-4]
CCDS44083.1. [P42892-2]
PIRiJC2521.
JC4136.
RefSeqiNP_001106818.1. NM_001113347.1. [P42892-2]
NP_001106819.1. NM_001113348.1. [P42892-3]
NP_001106820.1. NM_001113349.1. [P42892-4]
NP_001388.1. NM_001397.2. [P42892-1]
XP_006710461.1. XM_006710398.2.
XP_011539175.1. XM_011540873.2.
XP_016856000.1. XM_017000511.1.
UniGeneiHs.195080.

Genome annotation databases

EnsembliENST00000264205; ENSP00000264205; ENSG00000117298. [P42892-4]
ENST00000357071; ENSP00000349581; ENSG00000117298. [P42892-2]
ENST00000374893; ENSP00000364028; ENSG00000117298. [P42892-1]
ENST00000415912; ENSP00000405088; ENSG00000117298. [P42892-3]
GeneIDi1889.
KEGGihsa:1889.
UCSCiuc001bei.3. human. [P42892-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49471 mRNA. Translation: BAA08442.1.
D43698 mRNA. Translation: BAA07800.1.
X91922
, X91923, X91924, X91925, X91926, X91927, X91928, X91929, X91930, X91931, X91932, X91933, X91934, X91935, X91936, X91937, X91938, X91939 Genomic DNA. Translation: CAA63015.1.
X91923
, X91924, X91925, X91926, X91927, X91928, X91929, X91930, X91931, X91932, X91933, X91934, X91935, X91936, X91937, X91938, X91939 Genomic DNA. Translation: CAA63016.1.
AB031742 mRNA. Translation: BAA83687.1.
AK290656 mRNA. Translation: BAF83345.1.
AK304167 mRNA. Translation: BAG65053.1.
AY953519 Genomic DNA. Translation: AAX35820.1. Sequence problems.
AL031005 Genomic DNA. Translation: CAI20195.1.
AL031005, AL031728 Genomic DNA. Translation: CAI20192.1.
AL031005, AL031728 Genomic DNA. Translation: CAI20194.1.
AL031728 Genomic DNA. Translation: CAB52285.2.
AL031728, AL031005 Genomic DNA. Translation: CAI19064.1.
CH471134 Genomic DNA. Translation: EAW94959.1.
CH471134 Genomic DNA. Translation: EAW94964.1.
BC117256 mRNA. Translation: AAI17257.1.
BC126257 mRNA. Translation: AAI26258.1.
AJ130828 mRNA. Translation: CAB46443.1.
X98272 mRNA. Translation: CAA66922.1.
Z35307 mRNA. Translation: CAA84548.1. Different initiation.
AF018034 Genomic DNA. Translation: AAD21221.1.
CCDSiCCDS215.1. [P42892-1]
CCDS44081.1. [P42892-3]
CCDS44082.1. [P42892-4]
CCDS44083.1. [P42892-2]
PIRiJC2521.
JC4136.
RefSeqiNP_001106818.1. NM_001113347.1. [P42892-2]
NP_001106819.1. NM_001113348.1. [P42892-3]
NP_001106820.1. NM_001113349.1. [P42892-4]
NP_001388.1. NM_001397.2. [P42892-1]
XP_006710461.1. XM_006710398.2.
XP_011539175.1. XM_011540873.2.
XP_016856000.1. XM_017000511.1.
UniGeneiHs.195080.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3DWBX-ray2.38A101-770[»]
ProteinModelPortaliP42892.
SMRiP42892.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108218. 27 interactors.
IntActiP42892. 13 interactors.
STRINGi9606.ENSP00000364028.

Chemistry databases

BindingDBiP42892.
ChEMBLiCHEMBL4791.
GuidetoPHARMACOLOGYi1615.

Protein family/group databases

MEROPSiM13.002.

PTM databases

iPTMnetiP42892.
PhosphoSitePlusiP42892.
SwissPalmiP42892.

Polymorphism and mutation databases

BioMutaiECE1.
DMDMi1706563.

Proteomic databases

EPDiP42892.
MaxQBiP42892.
PaxDbiP42892.
PeptideAtlasiP42892.
PRIDEiP42892.

Protocols and materials databases

DNASUi1889.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264205; ENSP00000264205; ENSG00000117298. [P42892-4]
ENST00000357071; ENSP00000349581; ENSG00000117298. [P42892-2]
ENST00000374893; ENSP00000364028; ENSG00000117298. [P42892-1]
ENST00000415912; ENSP00000405088; ENSG00000117298. [P42892-3]
GeneIDi1889.
KEGGihsa:1889.
UCSCiuc001bei.3. human. [P42892-1]

Organism-specific databases

CTDi1889.
DisGeNETi1889.
GeneCardsiECE1.
GeneReviewsiECE1.
H-InvDBHIX0159964.
HGNCiHGNC:3146. ECE1.
HPAiHPA001490.
HPA013616.
MalaCardsiECE1.
MIMi600423. gene.
613870. phenotype.
neXtProtiNX_P42892.
OpenTargetsiENSG00000117298.
Orphaneti388. Hirschsprung disease.
PharmGKBiPA27594.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3624. Eukaryota.
COG3590. LUCA.
GeneTreeiENSGT00760000119162.
HOGENOMiHOG000245574.
HOVERGENiHBG005554.
InParanoidiP42892.
KOiK01415.
OMAiLQVNFHS.
OrthoDBiEOG091G025Y.
PhylomeDBiP42892.
TreeFamiTF315192.

Enzyme and pathway databases

BioCyciZFISH:HS04115-MONOMER.
BRENDAi3.4.24.71. 2681.

Miscellaneous databases

ChiTaRSiECE1. human.
EvolutionaryTraceiP42892.
GeneWikiiEndothelin_converting_enzyme_1.
GenomeRNAii1889.
PROiP42892.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000117298.
ExpressionAtlasiP42892. baseline and differential.
GenevisibleiP42892. HS.

Family and domain databases

CDDicd08662. M13. 1 hit.
Gene3Di3.40.390.10. 2 hits.
InterProiIPR029734. ECE1.
IPR024079. MetalloPept_cat_dom.
IPR000718. Peptidase_M13.
IPR018497. Peptidase_M13_C.
IPR008753. Peptidase_M13_N.
[Graphical view]
PANTHERiPTHR11733. PTHR11733. 1 hit.
PTHR11733:SF130. PTHR11733:SF130. 1 hit.
PfamiPF01431. Peptidase_M13. 1 hit.
PF05649. Peptidase_M13_N. 1 hit.
[Graphical view]
PRINTSiPR00786. NEPRILYSIN.
PROSITEiPS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiECE1_HUMAN
AccessioniPrimary (citable) accession number: P42892
Secondary accession number(s): A8K3P1
, B4E291, Q14217, Q17RN5, Q2Z2K8, Q58GE7, Q5THM5, Q5THM7, Q5THM8, Q9UJQ6, Q9UPF4, Q9UPM4, Q9Y501
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: October 1, 1996
Last modified: November 30, 2016
This is version 173 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.