P42866 (OPRM_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mu-type opioid receptor Short name=M-OR-1 Short name=MOR-1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 398 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for endogenous opioids such as beta-endorphin and endomorphin. Agonist binding to the receptor induces coupling to an inactive GDP-bound heterotrimeric G-protein complex and subsequent exchange of GDP for GTP in the G-protein alpha subunit leading to dissociation of the G-protein complex with the free GTP-bound G-protein alpha and the G-protein beta-gamma dimer activating downstream cellular effectors. The agonist- and cell type-specific activity is predominantly coupled to pertussis toxin-sensitive G(i) and G(o) G alpha proteins, GNAI1, GNAI2, GNAI3 and GNAO1 isoforms Alpha-1 and Alpha-2, and to a lesser extend to pertussis toxin-insensitive G alpha proteins GNAZ and GNA15. They mediate an array of downstream cellular responses, including inhibition of adenylate cyclase activity and both N-type and L-type calcium channels, activation of inward rectifying potassium channels, mitogen-activated protein kinase (MAPK), phospholipase C (PLC), phosphoinositide/protein kinase (PKC), phosphoinositide 3-kinase (PI3K) and regulation of NF-kappa-B. Also couples to adenylate cyclase stimulatory G alpha proteins. The selective temporal coupling to G-proteins and subsequent signaling can be regulated by RGSZ proteins, such as RGS9, RGS17 and RGS4. Phosphorylation by members of the GPRK subfamily of Ser/Thr protein kinases and association with beta-arrestins is involved in short-term receptor desensitization. Beta-arrestins associate with the GPRK-phosphorylated receptor and uncouple it from the G-protein thus terminating signal transduction. The phosphorylated receptor is internalized through endocytosis via clathrin-coated pits which involves beta-arrestins. The activation of the ERK pathway occurs either in a G-protein-dependent or a beta-arrestin-dependent manner and is regulated by agonist-specific receptor phosphorylation. Acts as a class A G-protein coupled receptor (GPCR) which dissociates from beta-arrestin at or near the plasma membrane and undergoes rapid recycling. Receptor down-regulation pathways are varying with the agonist and occur dependent or independent of G-protein coupling. Endogenous ligands induce rapid desensitization, endocytosis and recycling. Heterooligomerization with other GPCRs can modulate agonist binding, signaling and trafficking properties. Involved in neurogenesis. Isoform 9 is involved in morphine-induced scratching and seems to cross-activate GRPR in response to morphine. Ref.17 Ref.25 Ref.29 |
| Subunit structure | Forms homooligomers and heterooligomers with other GPCRs, such as OPRD1, OPRK1, OPRL1, NPFFR2, ADRA2A, SSTR2, CNR1 and CCR5 (probably in dimeric forms). Interacts with PPL; the interaction disrupts agonist-mediated G-protein activation. Interacts (via C-terminus) with DNAJB4 (via C-terminus). Interacts with calmodulin; the interaction inhibits the constitutive activity of OPRM1; it abolishes basal and attenuates agonist-stimulated G-protein coupling. Interacts with FLNA, PLD2, RANBP9 and WLS and GPM6A. Interacts with RTP4. Interacts with SYP and GNAS By similarity. Interacts with RGS9, RGS17, RGS20, RGS4, PPP1R9B and HINT1. Isoform 9 interacts with GRPR. Ref.19 Ref.20 Ref.24 Ref.26 Ref.27 Ref.28 Ref.29 Ref.30 Ref.31 |
| Subcellular location | |
| Post-translational modification | Phosphorylated. Differentially phosphorylated in basal and agonist-induced conditions. Agonist-mediated phosphorylation modulates receptor internalization. Phosphorylated by ADRBK1 in a agonist-dependent manner. Phosphorylation at Tyr-166 requires receptor activation, is dependent on non-receptor protein tyrosine kinase Src and results in a decrease in agonist efficacy by reducing G-protein coupling efficiency. Phosphorylated on tyrosine residues; the phosphorylation is involved in agoinist-induced G-protein-indepenedent receptor down-regulation. Phosphorylation at Ser-375 is involved in G-protein-dependent but not beta-arrestin-dependent activation of the ERK pathway. Ubiquitinated. A basal ubiquitination seems not to be related to degradation. Ubiquitination is increased upon formation of OPRM1:OPRD1 oligomers leading to proteasomal degradation; the ubiquitination is diminished by RTP4. Ref.28 |
| Disruption phenotype | During adult neurogenesis in hippocampus, increased numbers of granule cells maturing into neurons, larger granule cell layers and increased numbers of granule cells. Ref.25 |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Grpr | P21729 | 4 | EBI-6049667,EBI-6049651 |
Alternative products
| This entry describes 19 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. Functional relevance for short isoforms with one transmembrane domain only is unsure and these isoforms are not included. | ||||||
| Isoform 1 (identifier: P42866-1) Also known as: MOR-1; MOR-H; MOR-1J; MOR-1T; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P42866-2) Also known as: MOR-1A; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → VCAF | ||||||
| Isoform 3 (identifier: P42866-3) Also known as: MOR-1B1; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → KIDLF | ||||||
| Isoform 4 (identifier: P42866-4) Also known as: MOR-1B2; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → KLLMWRAMPTFKRHLAIMLSLDN | ||||||
| Isoform 5 (identifier: P42866-5) Also known as: MOR-1B3; MOR-1Q; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → TSLTLQ | ||||||
| Isoform 6 (identifier: P42866-6) Also known as: MOR-1B4; MOR-1R; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → AHQKPQECLKCRCLSLTILVICLHFQHQQFFIMIKKNVS | ||||||
| Isoform 7 (identifier: P42866-7) Also known as: MOR-1B5; MOR-1P; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → CV | ||||||
| Isoform 8 (identifier: P42866-8) Also known as: MOR-1C; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → PTLAVSVAQIFTGYPSPTHVEKPCKSCMDRGMRNLLPDDGPRQESGEGQLGR | ||||||
| Isoform 9 (identifier: P42866-9) Also known as: MOR-1D; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → RNEEPSS | ||||||
| Isoform 10 (identifier: P42866-10) Also known as: MOR-1E; MOR-1Eiii; MOR-1Eiv; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → KKKLDSQRGCVQHPV | ||||||
| Isoform 11 (identifier: P42866-11) Also known as: MOR-1F; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → APCACVPGANRGQTKASDLLDLELETVGSHQADAETNPGPYEGSKCAEPLAISLVPLY | ||||||
| Isoform 12 (identifier: P42866-12) Also known as: MOR-1O; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → PTLAVSVAQIFTGYPSPTHVEKPCKSCMDR | ||||||
| Isoform 13 (identifier: P42866-13) Also known as: MOR-1P; MOR-1R; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → IMKFEAIYPK...LRHMGPSYPS | ||||||
| Isoform 14 (identifier: P42866-14) Also known as: MOR-1G; The sequence of this isoform differs from the canonical sequence as follows: 1-94: MDSSAGPGNI...GNFLVMYVIV → MMEAFSKSAFQKLRQRDGNQEGKSYL | ||||||
| Isoform 15 (identifier: P42866-15) Also known as: MOR-1M; The sequence of this isoform differs from the canonical sequence as follows: 1-94: MDSSAGPGNI...GNFLVMYVIV → MMEAFSKSAFQKLRQRDGNQEGKSYL 387-398: LENLEAETAPLP → PTLAVSVAQIFTGYPSPTHVEKPCKSCMDRGMRNLLPDDGPRQESGEGQLGR | ||||||
| Isoform 16 (identifier: P42866-16) Also known as: MOR-1N; The sequence of this isoform differs from the canonical sequence as follows: 1-94: MDSSAGPGNI...GNFLVMYVIV → MMEAFSKSAFQKLRQRDGNQEGKSYL 387-398: LENLEAETAPLP → RNEEPSS | ||||||
| Isoform 17 (identifier: P42866-17) Also known as: MOR-1U; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → PTLAVSVAQI...QESGEGQLGR | ||||||
| Isoform 18 (identifier: P42866-18) Also known as: MOR-1V; The sequence of this isoform differs from the canonical sequence as follows: 387-398: LENLEAETAPLP → KQEKTKTKSAWEIWEQKEHTLLLGETHLTIQHLS | ||||||
| Isoform 19 (identifier: P42866-19) Also known as: MOR-1W; The sequence of this isoform differs from the canonical sequence as follows: 388-398: ENLEAETAPLP → AFGCCNEHHDQR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 398 | 398 | Mu-type opioid receptor | PRO_0000069975 | ||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||
| Topological domain | 1 – 64 | 64 | Extracellular Potential | |||||||||||||||||||||||||||||||
| Transmembrane | 65 – 94 | 30 | Helical; Name=1; Potential | |||||||||||||||||||||||||||||||
| Topological domain | 95 – 103 | 9 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||
| Transmembrane | 104 – 121 | 18 | Helical; Name=2; Potential | |||||||||||||||||||||||||||||||
| Topological domain | 122 – 143 | 22 | Extracellular Potential | |||||||||||||||||||||||||||||||
| Transmembrane | 144 – 163 | 20 | Helical; Name=3; Potential | |||||||||||||||||||||||||||||||
| Topological domain | 164 – 193 | 30 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||
| Transmembrane | 194 – 209 | 16 | Helical; Name=4; Potential | |||||||||||||||||||||||||||||||
| Topological domain | 210 – 234 | 25 | Extracellular Potential | |||||||||||||||||||||||||||||||
| Transmembrane | 235 – 257 | 23 | Helical; Name=5; Potential | |||||||||||||||||||||||||||||||
| Topological domain | 258 – 280 | 23 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||
| Transmembrane | 281 – 303 | 23 | Helical; Name=6; Potential | |||||||||||||||||||||||||||||||
| Topological domain | 304 – 311 | 8 | Extracellular Potential | |||||||||||||||||||||||||||||||
| Transmembrane | 312 – 328 | 17 | Helical; Name=7; Potential | |||||||||||||||||||||||||||||||
| Topological domain | 329 – 398 | 70 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||
| Modified residue | 166 | 1 | Phosphotyrosine By similarity | |||||||||||||||||||||||||||||||
| Modified residue | 363 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||
| Modified residue | 370 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||
| Modified residue | 375 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||
| Lipidation | 351 | 1 | S-palmitoyl cysteine Potential | |||||||||||||||||||||||||||||||
| Glycosylation | 9 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||
| Glycosylation | 31 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||
| Glycosylation | 38 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||
| Glycosylation | 46 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||
| Disulfide bond | 140 ↔ 217 | By similarity | ||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 94 | 94 | MDSSA…MYVIV → MMEAFSKSAFQKLRQRDGNQ EGKSYL in isoform 14, isoform 15 and isoform 16. | VSP_042332 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → KKKLDSQRGCVQHPV in isoform 10. | VSP_042333 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → APCACVPGANRGQTKASDLL DLELETVGSHQADAETNPGP YEGSKCAEPLAISLVPLY in isoform 11. | VSP_042334 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → PTLAVSVAQIFTGYPSPTHV EKPCKSCMDR in isoform 12. | VSP_042335 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → IMKFEAIYPKLSFKSWALKY FTFIREKKRNTKAGALPTCH AGSPSQAHRGVAAWLLPLRH MGPSYPS in isoform 13. | VSP_042336 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → PTLAVSVAQIFTGYPSPTHV EKPCKSCMDSVDCYNRKQQT GSLRKNKKKKKRRKNKQNIL EAGISRGMRNLLPDDGPRQE SGEGQLGR in isoform 17. | VSP_042337 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → KQEKTKTKSAWEIWEQKEHT LLLGETHLTIQHLS in isoform 18. | VSP_042338 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → VCAF in isoform 2. | VSP_042339 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → KIDLF in isoform 3. | VSP_042340 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → KLLMWRAMPTFKRHLAIMLS LDN in isoform 4. | VSP_042341 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → TSLTLQ in isoform 5. | VSP_042342 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → AHQKPQECLKCRCLSLTILV ICLHFQHQQFFIMIKKNVS in isoform 6. | VSP_042343 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → CV in isoform 7. | VSP_042344 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → PTLAVSVAQIFTGYPSPTHV EKPCKSCMDRGMRNLLPDDG PRQESGEGQLGR in isoform 8 and isoform 15. | VSP_042345 | ||||||||||||||||||||||||||||||
| Alternative sequence | 387 – 398 | 12 | LENLE…TAPLP → RNEEPSS in isoform 9 and isoform 16. | VSP_042346 | ||||||||||||||||||||||||||||||
| Alternative sequence | 388 – 398 | 11 | ENLEAETAPLP → AFGCCNEHHDQR in isoform 19. | VSP_042347 | ||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 387 | 1 | L → A: Abolishes receptor recycling; when associated with A-390. Ref.22 | |||||||||||||||||||||||||||||||
| Mutagenesis | 390 | 1 | L → A: Abolishes receptor recycling; when associated with A-387. Ref.22 | |||||||||||||||||||||||||||||||
| Sequence conflict | 22 | 1 | C → W in AAA86878. Ref.3 | |||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||
| Helix | 66 – 95 | 30 | ||||||||||||||||||||||||||||||||
| Helix | 102 – 130 | 29 | ||||||||||||||||||||||||||||||||
| Helix | 138 – 170 | 33 | ||||||||||||||||||||||||||||||||
| Helix | 172 – 178 | 7 | ||||||||||||||||||||||||||||||||
| Helix | 181 – 204 | 24 | ||||||||||||||||||||||||||||||||
| Beta strand | 209 – 211 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 214 – 216 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 222 – 224 | 3 | ||||||||||||||||||||||||||||||||
| Helix | 225 – 239 | 15 | ||||||||||||||||||||||||||||||||
| Helix | 242 – 258 | 17 | ||||||||||||||||||||||||||||||||
| Helix | 273 – 305 | 33 | ||||||||||||||||||||||||||||||||
| Helix | 312 – 339 | 28 | ||||||||||||||||||||||||||||||||
| Helix | 341 – 351 | 11 | ||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Genomic structure analysis of promoter sequence of a mouse mu opioid receptor gene." Min B.H., Augustin L.B., Felsheim R.F., Fuchs J.A., Loh H.H. Proc. Natl. Acad. Sci. U.S.A. 91:9081-9085(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: C57BL/6. Tissue: Liver. |
| [2] | "Antisense mapping the MOR-1 opioid receptor: evidence for alternative splicing and a novel morphine-6 beta-glucuronide receptor." Rossi G.C., Pan Y.X., Brown G.P., Pasternak G.W. FEBS Lett. 369:192-196(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Characterization of the murine mu opioid receptor gene." Kaufman D.L., Keith D.E., Anton B., Tian J., Magendzo K., Newman D., Tran T., Lee D.S., Wen C., Xia Y., Lusis A.J., Evans C.J. J. Biol. Chem. 270:15877-15883(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: BALB/c. Tissue: Brain. |
| [4] | "Identification and characterization of three new alternatively spliced mu-opioid receptor isoforms." Pan Y.X., Xu J., Bolan E., Abbadie C., Chang A., Zuckerman A., Rossi G., Pasternak G.W. Mol. Pharmacol. 56:396-403(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 8; 9 AND 10). Strain: C57BL/6. |
| [5] | "Identification and characterization of a mouse spliced mu-opioid receptor isoform (MOR-1A)." Pan Y.-X., Xu J., Chang A., Pasternak G.W. Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: CD-1. |
| [6] | "Isolation and expression of a novel alternatively spliced mu opioid receptor isoform, MOR-1F." Pan Y.X., Xu J., Bolan E., Chang A., Mahurter L., Rossi G., Pasternak G.W. FEBS Lett. 466:337-340(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 11). Strain: CD-1. |
| [7] | "The untranslated region of (mu)-opioid receptor mRNA contributes to reduced opioid sensitivity in CXBK mice." Ikeda K., Kobayashi T., Ichikawa T., Kumanishi T., Niki H., Yano R. J. Neurosci. 21:1334-1339(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: C57BL/6By x BALB/cBy. Tissue: Brain. |
| [8] | "Generation of the mu opioid receptor (MOR-1) protein by three new splice variants of the Oprm gene." Pan Y.X., Xu J., Mahurter L., Bolan E., Xu M., Pasternak G.W. Proc. Natl. Acad. Sci. U.S.A. 98:14084-14089(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 14; 15 AND 16). Strain: C57BL/6By x BALB/cBy. |
| [9] | "Identification and characterization of a novel splice variant from mouse mu opioid receptor gene (Oprm)." Pan Y., Xu J., Xu M., Pasternak G.W. Submitted (MAY-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 13). |
| [10] | "Identification and characterization of a new isoform from mouse mu opioid receptor gene Oprm." Xu J., Pasternak G.W. Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 12). Strain: CD-1. |
| [11] | "Identification of four novel exon 5 splice variants of the mouse mu-opioid receptor gene: functional consequences of C-terminal splicing." Pan Y.X., Xu J., Bolan E., Moskowitz H.S., Xu M., Pasternak G.W. Mol. Pharmacol. 68:866-875(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4; 5; 6 AND 7). Strain: CD-1. |
| [12] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8). |
| [13] | "Identification of five mouse mu-opioid receptor (MOR) gene (Oprm1) splice variants containing a newly identified alternatively spliced exon." Doyle G.A., Sheng X.R., Lin S.S., Press D.M., Grice D.E., Buono R.J., Ferraro T.N., Berrettini W.H. Gene 395:98-107(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 10; 17; 18 AND 19). Strain: C57BL/6. Tissue: Brain. |
| [14] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [15] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [16] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8). |
| [17] | "Opiate receptor knockout mice define mu receptor roles in endogenous nociceptive responses and morphine-induced analgesia." Sora I., Takahashi N., Funada M., Ujike H., Revay R.S., Donovan D.M., Miner L.L., Uhl G.R. Proc. Natl. Acad. Sci. U.S.A. 94:1544-1549(1997) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [18] | "Influence of Gz and Gi2 transducer proteins in the affinity of opioid agonists to mu receptors." Garzon J., Castro M., Sanchez-Blazquez P. Eur. J. Neurosci. 10:2557-2564(1998) [PubMed] [Europe PMC] [Abstract] Cited for: COUPLING TO GNAZ. |
| [19] | "Oligomerization of mu- and delta-opioid receptors. Generation of novel functional properties." George S.R., Fan T., Xie Z., Tse R., Tam V., Varghese G., O'Dowd B.F. J. Biol. Chem. 275:26128-26135(2000) [PubMed] [Europe PMC] [Abstract] Cited for: RECEPTOR HETEROOLIGOMERIZATION, INTERACTION WITH OPRD1. |
| [20] | "Dimerization of morphine and orphanin FQ/nociceptin receptors: generation of a novel opioid receptor subtype." Pan Y.X., Bolan E., Pasternak G.W. Biochem. Biophys. Res. Commun. 297:659-663(2002) [PubMed] [Europe PMC] [Abstract] Cited for: RECEPTOR HETEROOLIGOMERIZATION, INTERACTION WITH OPRL1. |
| [21] | "Opioid agonists have different efficacy profiles for G protein activation, rapid desensitization, and endocytosis of mu-opioid receptors." Borgland S.L., Connor M., Osborne P.B., Furness J.B., Christie M.J. J. Biol. Chem. 278:18776-18784(2003) [PubMed] [Europe PMC] [Abstract] Cited for: RECEPTOR DESENSITIZATION, RECEPTOR INTERNALIZATION. |
| [22] | "A novel endocytic recycling signal that distinguishes the membrane trafficking of naturally occurring opioid receptors." Tanowitz M., von Zastrow M. J. Biol. Chem. 278:45978-45986(2003) [PubMed] [Europe PMC] [Abstract] Cited for: RECEPTOR RECYCLING, MUTAGENESIS OF LEU-387 AND LEU-390. |
| [23] | "Genetic analysis of the murine mu opioid receptor: increased complexity of Oprm gene splicing." Kvam T.M., Baar C., Rakvag T.T., Kaasa S., Krokan H.E., Skorpen F. J. Mol. Med. 82:250-255(2004) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| [24] | "The RGSZ2 protein exists in a complex with mu-opioid receptors and regulates the desensitizing capacity of Gz proteins." Garzan J., Rodriguez-Munoz M., Lopez-Fando A., Sanchez-Blazquez P. Neuropsychopharmacology 30:1632-1648(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RGS17 AND RGS20. |
| [25] | "mu opioid and CB1 cannabinoid receptor interactions: reciprocal inhibition of receptor signaling and neuritogenesis." Rios C., Gomes I., Devi L.A. Br. J. Pharmacol. 148:387-395(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [26] | "RGS9-2 is a negative modulator of mu-opioid receptor function." Psifogeorgou K., Papakosta P., Russo S.J., Neve R.L., Kardassis D., Gold S.J., Zachariou V. J. Neurochem. 103:617-625(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RGS9. |
| [27] | "Multiple actions of spinophilin regulate mu opioid receptor function." Charlton J.J., Allen P.B., Psifogeorgou K., Chakravarty S., Gomes I., Neve R.L., Devi L.A., Greengard P., Nestler E.J., Zachariou V. Neuron 58:238-247(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PPP1R9B. |
| [28] | "Cell surface targeting of mu-delta opioid receptor heterodimers by RTP4." Decaillot F.M., Rozenfeld R., Gupta A., Devi L.A. Proc. Natl. Acad. Sci. U.S.A. 105:16045-16050(2008) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION, RECEPTOR HETEROOLIGOMERIZATION, INTERACTION WITH OPRD1 AND RTP4. |
| [29] | "Unidirectional cross-activation of GRPR by MOR1D uncouples itch and analgesia induced by opioids." Liu X.Y., Liu Z.C., Sun Y.G., Ross M., Kim S., Tsai F.F., Li Q.F., Jeffry J., Kim J.Y., Loh H.H., Chen Z.F. Cell 147:447-458(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION (ISOFORM 9), INTERACTION WITH GRPR. |
| [30] | "The histidine triad nucleotide-binding protein 1 supports mu-opioid receptor-glutamate NMDA receptor cross-regulation." Rodriguez-Munoz M., Sanchez-Blazquez P., Vicente-Sanchez A., Bailon C., Martin-Aznar B., Garzon J. Cell. Mol. Life Sci. 68:2933-2949(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HINT1. |
| [31] | "Heteromerization of the mu- and delta-opioid receptors produces ligand-biased antagonism and alters mu-receptor trafficking." Milan-Lobo L., Whistler J.L. J. Pharmacol. Exp. Ther. 337:868-875(2011) [PubMed] [Europe PMC] [Abstract] Cited for: RECEPTOR HETEROOLIGOMERIZATION, INTERACTION WITH OPRD1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U10561 U10560 Genomic DNA. Translation: AAB60673.1.U26915 mRNA. Translation: AAA81170.1. U19380 mRNA. Translation: AAA86878.1. AF062753 mRNA. Translation: AAD54415.1. AF074973 mRNA. Translation: AAD51861.1. AF074974 mRNA. Translation: AAD51862.1. AF167565 mRNA. Translation: AAL55581.1. AF167568 mRNA. Translation: AAF79213.1. AB047546 mRNA. Translation: BAB63338.1. AF062755 mRNA. Translation: AAL34927.1. AF260311 mRNA. Translation: AAL34400.1. AF074972 mRNA. Translation: AAL34394.1. AF400246 mRNA. Translation: AAL34507.1. AF400247 mRNA. Translation: AAL34508.1. AF400248 mRNA. Translation: AAL34509.1. AY036621 mRNA. Translation: AAK74188.1. AY160190 mRNA. Translation: AAO18365.1. AF167566 mRNA. Translation: AAL55582.1. AF167567 mRNA. Translation: AAL55583.1. AF346812 mRNA. Translation: AAO13792.1. AF346813 mRNA. Translation: AAO13793.1. AF346814 mRNA. Translation: AAO13794.1. AK038389 mRNA. Translation: BAC29982.1. DQ363376 mRNA. Translation: ABC94862.1. DQ363377 mRNA. Translation: ABC94863.1. DQ868787 mRNA. Translation: ABI95796.1. DQ868788 mRNA. Translation: ABI95797.2. EF105311 mRNA. Translation: ABN45760.1. EF105312 mRNA. Translation: ABN45761.1. EF105313 mRNA. Translation: ABN45762.1. EF105314 mRNA. Translation: ABN45763.1. CH466562 Genomic DNA. Translation: EDL03560.1. CH466562 Genomic DNA. Translation: EDL03561.1. CH466562 Genomic DNA. Translation: EDL03562.1. AC153981 Genomic DNA. No translation available. AC155718 Genomic DNA. No translation available. AC164171 Genomic DNA. No translation available. BC119545 mRNA. Translation: AAI19546.1. | ||||||||||||
| IPI | IPI00275785. IPI00407611. IPI00407615. IPI00466584. IPI00474414. IPI00753476. IPI00831334. IPI00854909. IPI00856477. IPI00857528. IPI00857667. IPI00857924. IPI00858088. IPI00858112. IPI00922995. IPI01027204. | ||||||||||||
| PIR | A57510. | ||||||||||||
| RefSeq | NP_001034741.1. NM_001039652.1. | ||||||||||||
| UniGene | Mm.439715. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P42866. | ||||||||||||
| SMR | P42866. Positions 65-352. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-46148N. | ||||||||||||
| IntAct | P42866. 5 interactions. | ||||||||||||
| STRING | 10090.ENSMUSP00000101239. | ||||||||||||
Protein family/group databases | |||||||||||||
| GPCRDB | Search... | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P42866. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P42866. | ||||||||||||
| PRIDE | P42866. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000000783; ENSMUSP00000000783; ENSMUSG00000000766. ENSMUST00000052751; ENSMUSP00000060329; ENSMUSG00000000766. ENSMUST00000056385; ENSMUSP00000060590; ENSMUSG00000000766. ENSMUST00000063036; ENSMUSP00000053498; ENSMUSG00000000766. ENSMUST00000078634; ENSMUSP00000077704; ENSMUSG00000000766. ENSMUST00000092729; ENSMUSP00000090405; ENSMUSG00000000766. ENSMUST00000092731; ENSMUSP00000090407; ENSMUSG00000000766. ENSMUST00000092734; ENSMUSP00000090410; ENSMUSG00000000766. ENSMUST00000105602; ENSMUSP00000101227; ENSMUSG00000000766. ENSMUST00000105605; ENSMUSP00000101230; ENSMUSG00000000766. ENSMUST00000105607; ENSMUSP00000101232; ENSMUSG00000000766. ENSMUST00000105611; ENSMUSP00000101236; ENSMUSG00000000766. ENSMUST00000105615; ENSMUSP00000101240; ENSMUSG00000000766. ENSMUST00000135502; ENSMUSP00000135143; ENSMUSG00000000766. ENSMUST00000144264; ENSMUSP00000115836; ENSMUSG00000000766. ENSMUST00000147171; ENSMUSP00000117950; ENSMUSG00000000766. ENSMUST00000154906; ENSMUSP00000114342; ENSMUSG00000000766. | ||||||||||||
| GeneID | 18390. | ||||||||||||
| KEGG | mmu:18390. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 4988. | ||||||||||||
| MGI | MGI:97441. Oprm1. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG279457. | ||||||||||||
| GeneTree | ENSGT00630000089574. | ||||||||||||
| HOGENOM | HOG000230486. | ||||||||||||
| HOVERGEN | HBG106919. | ||||||||||||
| KO | K04215. | ||||||||||||
| OMA | HASTANT. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P42866. | ||||||||||||
| Bgee | P42866. | ||||||||||||
| CleanEx | MM_OPRM1. | ||||||||||||
| Genevestigator | P42866. | ||||||||||||
| GermOnline | ENSMUSG00000000766. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000276. GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_7TM. IPR000105. Mu_opioid_rcpt. IPR001418. Opioid_rcpt. [Graphical view] | ||||||||||||
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00237. GPCRRHODOPSN. PR00537. MUOPIOIDR. PR00384. OPIOIDR. | ||||||||||||
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. 1 hit. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | P42866. | ||||||||||||
| ChEMBL | CHEMBL2858. | ||||||||||||
| NextBio | 293988. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | OPRM_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P42866 Secondary accession number(s): A1XGX3 Q9R1M0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
