Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Beta carbonic anhydrase 2, chloroplastic

Gene

BCA2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Reversible hydration of carbon dioxide. This isoform ensures the supply of bicarbonate for pep carboxylase.

Catalytic activityi

H2CO3 = CO2 + H2O.

Pathwayi: C4 acid pathway

This protein is involved in the pathway C4 acid pathway, which is part of Photosynthesis.
View all proteins of this organism that are known to be involved in the pathway C4 acid pathway and in Photosynthesis.

GO - Molecular functioni

GO - Biological processi

  • carbon utilization Source: InterPro
  • defense response to bacterium Source: TAIR

Keywordsi

Molecular functionLyase
LigandZinc

Enzyme and pathway databases

UniPathwayiUPA00322

Names & Taxonomyi

Protein namesi
Recommended name:
Beta carbonic anhydrase 2, chloroplastic (EC:4.2.1.1)
Short name:
AtbCA2
Short name:
AtbetaCA2
Alternative name(s):
Beta carbonate dehydratase 2
Gene namesi
Name:BCA2
Synonyms:CA18, CA2
Ordered Locus Names:At5g14740
ORF Names:T9L3.40
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 5

Organism-specific databases

AraportiAT5G14740
TAIRilocus:2185460 AT5G14740

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chloroplast, Cytoplasm, Plastid

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 71ChloroplastSequence analysisAdd BLAST71
ChainiPRO_000007745872 – 331Beta carbonic anhydrase 2, chloroplasticAdd BLAST260
Isoform 2 (identifier: P42737-2)
Initiator methionineiRemovedCombined sources

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei107PhosphothreonineCombined sources1
Modified residuei170PhosphoserineCombined sources1
Modified residuei198PhosphotyrosineCombined sources1
Modified residuei275S-nitrosocysteineBy similarity1
Isoform 2 (identifier: P42737-2)
Modified residuei2N-acetylglycineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein, S-nitrosylation

Proteomic databases

PaxDbiP42737
PRIDEiP42737

2D gel databases

SWISS-2DPAGEiP42737

PTM databases

iPTMnetiP42737

Expressioni

Tissue specificityi

Strongly expressed in aerial tissues including leaves, stems, flowers and siliques. Accumulates in mesophyll cells.2 Publications

Inductioni

Expression reduced by 20% under dark conditions.

Gene expression databases

ExpressionAtlasiP42737 baseline and differential
GenevisibleiP42737 AT

Interactioni

Protein-protein interaction databases

BioGridi16603, 2 interactors
IntActiP42737, 50 interactors
STRINGi3702.AT5G14740.1

Structurei

3D structure databases

ProteinModelPortaliP42737
SMRiP42737
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG1578 Eukaryota
COG0288 LUCA
HOGENOMiHOG000125183
InParanoidiP42737
KOiK01673
OMAiANGACFR
OrthoDBiEOG09360LL4

Family and domain databases

Gene3Di3.40.1050.10, 1 hit
InterProiView protein in InterPro
IPR001765 Carbonic_anhydrase
IPR015892 Carbonic_anhydrase_CS
IPR036874 Carbonic_anhydrase_sf
PfamiView protein in Pfam
PF00484 Pro_CA, 1 hit
SMARTiView protein in SMART
SM00947 Pro_CA, 1 hit
SUPFAMiSSF53056 SSF53056, 1 hit
PROSITEiView protein in PROSITE
PS00704 PROK_CO2_ANHYDRASE_1, 1 hit
PS00705 PROK_CO2_ANHYDRASE_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist. According to EST sequences.
Isoform 1 (identifier: P42737-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVPFWTTVSR NGSSDSETTL QSASKATKQY KYPSLRPSHR LSLLFLFPFH
60 70 80 90 100
LSANGACFRC TCFSHFKLEL RRMGNESYED AIEALKKLLI EKDDLKDVAA
110 120 130 140 150
AKVKKITAEL QAASSSDSKS FDPVERIKEG FVTFKKEKYE TNPALYGELA
160 170 180 190 200
KGQSPKYMVF ACSDSRVCPS HVLDFHPGDA FVVRNIANMV PPFDKVKYAG
210 220 230 240 250
VGAAIEYAVL HLKVENIVVI GHSACGGIKG LMSFPLDGNN STDFIEDWVK
260 270 280 290 300
ICLPAKSKVL AESESSAFED QCGRCEREAV NVSLANLLTY PFVREGVVKG
310 320 330
TLALKGGYYD FVNGSFELWE LQFGISPVHS I
Length:331
Mass (Da):36,615
Last modified:July 9, 2014 - v3
Checksum:i31F5B61B9D262254
GO
Isoform 2 (identifier: P42737-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MVPFWTTVSRNGSSDSETTLQSASKATKQYKYPSLRPSHRLSLLFLFPFHLSANGACFRCTCFSHFKLELRRM → M

Show »
Length:259
Mass (Da):28,344
Checksum:iE329D4DAEF350CE0
GO

Sequence cautioni

The sequence AAA50156 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAG40063 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAG41445 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAN31799 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAN31810 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAC01873 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti109 – 110EL → DV in AAA50156 (PubMed:7520589).Curated2
Sequence conflicti287 – 288LL → RC in AAA50156 (PubMed:7520589).Curated2
Sequence conflicti310D → A in AAA50156 (PubMed:7520589).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0550681 – 73MVPFW…ELRRM → M in isoform 2. 3 PublicationsAdd BLAST73

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL391149 Genomic DNA Translation: CAC01873.1 Sequence problems.
CP002688 Genomic DNA Translation: AED92068.1
CP002688 Genomic DNA Translation: AED92069.1
CP002688 Genomic DNA Translation: ANM68481.1
CP002688 Genomic DNA Translation: ANM68482.1
CP002688 Genomic DNA Translation: ANM68483.1
CP002688 Genomic DNA Translation: ANM68484.1
AF324712 mRNA Translation: AAG40063.1 Different initiation.
AF326863 mRNA Translation: AAG41445.1 Different initiation.
AF339686 mRNA Translation: AAK00368.1
AF428428 mRNA Translation: AAL16197.1
BT000652 mRNA Translation: AAN31799.1 Different initiation.
BT000663 mRNA Translation: AAN31810.1 Different initiation.
AK317585 mRNA Translation: BAH20249.1
L18901 mRNA Translation: AAA50156.1 Different initiation.
Z26538 mRNA Translation: CAA81309.1
RefSeqiNP_001330235.1, NM_001343359.1 [P42737-2]
NP_001330236.1, NM_001343360.1 [P42737-2]
NP_001330237.1, NM_001343361.1 [P42737-2]
NP_001330238.1, NM_001343362.1 [P42737-2]
NP_568303.2, NM_121478.4 [P42737-1]
NP_974782.1, NM_203053.2 [P42737-2]
UniGeneiAt.23743

Genome annotation databases

EnsemblPlantsiAT5G14740.1; AT5G14740.1; AT5G14740 [P42737-1]
AT5G14740.2; AT5G14740.2; AT5G14740 [P42737-2]
AT5G14740.6; AT5G14740.6; AT5G14740 [P42737-2]
AT5G14740.7; AT5G14740.7; AT5G14740 [P42737-2]
AT5G14740.8; AT5G14740.8; AT5G14740 [P42737-2]
AT5G14740.9; AT5G14740.9; AT5G14740 [P42737-2]
GeneIDi831326
GrameneiAT5G14740.1; AT5G14740.1; AT5G14740 [P42737-1]
AT5G14740.2; AT5G14740.2; AT5G14740 [P42737-2]
AT5G14740.6; AT5G14740.6; AT5G14740 [P42737-2]
AT5G14740.7; AT5G14740.7; AT5G14740 [P42737-2]
AT5G14740.8; AT5G14740.8; AT5G14740 [P42737-2]
AT5G14740.9; AT5G14740.9; AT5G14740 [P42737-2]
KEGGiath:AT5G14740

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiBCA2_ARATH
AccessioniPrimary (citable) accession number: P42737
Secondary accession number(s): B9DHN2
, F4K874, Q42116, Q9FDZ0, Q9LER2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: July 9, 2014
Last modified: April 25, 2018
This is version 153 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health