Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable helicase with zinc finger domain

Gene

HELZ

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May act as a helicase that plays a role in RNA metabolism in multiple tissues and organs within the developing embryo.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri178 – 20629C3H1-typePROSITE-ProRule annotationAdd
BLAST
Nucleotide bindingi668 – 6758ATPSequence analysis

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • helicase activity Source: UniProtKB-KW
  • metal ion binding Source: UniProtKB-KW
  • poly(A) RNA binding Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Helicase, Hydrolase

Keywords - Ligandi

ATP-binding, Metal-binding, Nucleotide-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Probable helicase with zinc finger domain (EC:3.6.4.-)
Alternative name(s):
Down-regulated in human cancers protein
Gene namesi
Name:HELZ
Synonyms:DRHC, KIAA0054
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:16878. HELZ.

Subcellular locationi

GO - Cellular componenti

  • membrane Source: UniProtKB
  • nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Polymorphism and mutation databases

DMDMi221222452.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 19421942Probable helicase with zinc finger domainPRO_0000089185Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1614 – 16141PhosphoserineCombined sources
Modified residuei1738 – 17381PhosphoserineCombined sources
Modified residuei1741 – 17411PhosphoserineBy similarity
Modified residuei1766 – 17661PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP42694.
MaxQBiP42694.
PaxDbiP42694.
PRIDEiP42694.

PTM databases

iPTMnetiP42694.
PhosphoSiteiP42694.

Expressioni

Tissue specificityi

Expressed predominantly in thymus and brain. Expression is down-regulated in 28 of 95 tested cancer cell lines.1 Publication

Gene expression databases

BgeeiP42694.
CleanExiHS_HELZ.
ExpressionAtlasiP42694. baseline and differential.
GenevisibleiP42694. HS.

Organism-specific databases

HPAiHPA028276.

Interactioni

Subunit structurei

Interacts with SMYD2 (By similarity). Interacts with POLR2A. Interacts with SMYD3; the interaction may bridge SMYD3 and RNA polymerase II.By similarity1 Publication

Protein-protein interaction databases

IntActiP42694. 14 interactions.
MINTiMINT-5005990.
STRINGi9606.ENSP00000351524.

Structurei

3D structure databases

ProteinModelPortaliP42694.
SMRiP42694. Positions 642-1054.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi794 – 7974DEAA box

Sequence similaritiesi

Belongs to the DNA2/NAM7 helicase family.Curated
Contains 1 C3H1-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri178 – 20629C3H1-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG1804. Eukaryota.
COG1112. LUCA.
GeneTreeiENSGT00800000124068.
HOVERGENiHBG031603.
InParanoidiP42694.
OrthoDBiEOG7H791D.
PhylomeDBiP42694.
TreeFamiTF323999.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
4.10.1000.10. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR000571. Znf_CCCH.
[Graphical view]
PfamiPF00642. zf-CCCH. 1 hit.
[Graphical view]
SMARTiSM00356. ZnF_C3H1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
SSF90229. SSF90229. 1 hit.
PROSITEiPS50103. ZF_C3H1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P42694-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDRRAEKSC EQACESLKRQ DYEMALKHCT EALLSLGQYS MADFTGPCPL
60 70 80 90 100
EIERIKIESL LYRIASFLQL KNYVQADEDC RHVLGEGLAK GEDAFRAVLC
110 120 130 140 150
CMQLKGKLQP VSTILAKSLT GESLNGMVTK DLTRLKTLLS ETETATSNAL
160 170 180 190 200
SGYHVEDLDE GSCNGWHFRP PPRGITSSEE YTLCKRFLEQ GICRYGAQCT
210 220 230 240 250
SAHSQEELAE WQKRYASRLI KLKQQNENKQ LSGSYMETLI EKWMNSLSPE
260 270 280 290 300
KVLSECIEGV KVEHNPDLSV TVSTKKSHQT WTFALTCKPA RMLYRVALLY
310 320 330 340 350
DAHRPHFSII AISAGDSTTQ VSQEVPENCQ EWIGGKMAQN GLDHYVYKVG
360 370 380 390 400
IAFNTEIFGT FRQTIVFDFG LEPVLMQRVM IDAASTEDLE YLMHAKQQLV
410 420 430 440 450
TTAKRWDSSS KTIIDFEPNE TTDLEKSLLI RYQIPLSADQ LFTQSVLDKS
460 470 480 490 500
LTKSNYQSRL HDLLYIEEIA QYKEISKFNL KVQLQILASF MLTGVSGGAK
510 520 530 540 550
YAQNGQLFGR FKLTETLSED TLAGRLVMTK VNAVYLLPVP KQKLVQTQGT
560 570 580 590 600
KEKVYEATIE EKTKEYIFLR LSRECCEELN LRPDCDTQVE LQFQLNRLPL
610 620 630 640 650
CEMHYALDRI KDNGVLFPDI SMTPTIPWSP NRQWDEQLDP RLNAKQKEAV
660 670 680 690 700
LAITTPLAIQ LPPVLIIGPY GTGKTFTLAQ AVKHILQQQE TRILICTHSN
710 720 730 740 750
SAADLYIKDY LHPYVEAGNP QARPLRVYFR NRWVKTVHPV VHQYCLISSA
760 770 780 790 800
HSTFQMPQKE DILKHRVVVV TLNTSQYLCQ LDLEPGFFTH ILLDEAAQAM
810 820 830 840 850
ECETIMPLAL ATQNTRIVLA GDHMQLSPFV YSEFARERNL HVSLLDRLYE
860 870 880 890 900
HYPAEFPCRI LLCENYRSHE AIINYTSELF YEGKLMASGK QPAHKDFYPL
910 920 930 940 950
TFFTARGEDV QEKNSTAFYN NAEVFEVVER VEELRRKWPV AWGKLDDGSI
960 970 980 990 1000
GVVTPYADQV FRIRAELRKK RLSDVNVERV LNVQGKQFRV LFLSTVRTRH
1010 1020 1030 1040 1050
TCKHKQTPIK KKEQLLEDST EDLDYGFLSN YKLLNTAITR AQSLVAVVGD
1060 1070 1080 1090 1100
PIALCSIGRC RKFWERFIAL CHENSSLHGI TFEQIKAQLE ALELKKTYVL
1110 1120 1130 1140 1150
NPLAPEFIPR ALRLQHSGST NKQQQSPPKG KSLHHTQNDH FQNDGIVQPN
1160 1170 1180 1190 1200
PSVLIGNPIR AYTPPPPLGP HPNLGKSPSP VQRIDPHTGT SILYVPAVYG
1210 1220 1230 1240 1250
GNVVMSVPLP VPWTGYQGRF AVDPRIITHQ AAMAYNMNLL QTHGRGSPIP
1260 1270 1280 1290 1300
YGLGHHPPVT IGQPQNQHQE KDQHEQNRNG KSDTNNSGPE INKIRTPEKK
1310 1320 1330 1340 1350
PTEPKQVDLE SNPQNRSPES RPSVVYPSTK FPRKDNLNPR HINLPLPAPH
1360 1370 1380 1390 1400
AQYAIPNRHF HPLPQLPRPP FPIPQQHTLL NQQQNNLPEQ PNQIPPQPNQ
1410 1420 1430 1440 1450
VVQQQSQLNQ QPQQPPPQLS PAYQAGPNNA FFNSAVAHRP QSPPAEAVIP
1460 1470 1480 1490 1500
EQQPPPMLQE GHSPLRAIAQ PGPILPSHLN SFIDENPSGL PIGEALDRIH
1510 1520 1530 1540 1550
GSVALETLRQ QQARFQQWSE HHAFLSQGSA PYPHHHHPHL QHLPQPPLGL
1560 1570 1580 1590 1600
HQPPVRADWK LTSSAEDEVE TTYSRFQDLI RELSHRDQSE TRELAEMPPP
1610 1620 1630 1640 1650
QSRLLQYRQV QSRSPPAVPS PPSSTDHSSH FSNFNDNSRD IEVASNPAFP
1660 1670 1680 1690 1700
QRLPPQIFNS PFSLPSEHLA PPPLKYLAPD GAWTFANLQQ NHLMGPGFPY
1710 1720 1730 1740 1750
GLPPLPHRPP QNPFVQIQNH QHAIGQEPFH PLSSRTVSSS SLPSLEEYEP
1760 1770 1780 1790 1800
RGPGRPLYQR RISSSSVQPC SEEVSTPQDS LAQCKELQDH SNQSSFNFSS
1810 1820 1830 1840 1850
PESWVNTTSS TPYQNIPCNG SSRTAQPREL IAPPKTVKPP EDQLKSENLE
1860 1870 1880 1890 1900
VSSSFNYSVL QHLGQFPPLM PNKQIAESAN SSSPQSSAGG KPAMSYASAL
1910 1920 1930 1940
RAPPKPRPPP EQAKKSSDPL SLFQELSLGS SSGSNGFYSY FK
Length:1,942
Mass (Da):218,970
Last modified:January 20, 2009 - v2
Checksum:iB2EA41681C1A327D
GO
Isoform 2 (identifier: P42694-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     691-691: T → TS
     1130-1162: GKSLHHTQNDHFQNDGIVQPNPSVLIGNPIRAY → VKPLLMKLKRLKGENFAEVPKVYWDASYFKCWN
     1163-1942: Missing.

Note: No experimental confirmation available.
Show »
Length:1,163
Mass (Da):133,060
Checksum:i7E7DE68763BF9A24
GO

Sequence cautioni

The sequence BAA06147.3 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti48 – 481C → R.
Corresponds to variant rs2302669 [ dbSNP | Ensembl ].
VAR_057273
Natural varianti74 – 741V → M.
Corresponds to variant rs8080100 [ dbSNP | Ensembl ].
VAR_057274
Natural varianti1530 – 15301A → V.
Corresponds to variant rs11653020 [ dbSNP | Ensembl ].
VAR_057275

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei691 – 6911T → TS in isoform 2. 1 PublicationVSP_054493
Alternative sequencei1130 – 116233GKSLH…PIRAY → VKPLLMKLKRLKGENFAEVP KVYWDASYFKCWN in isoform 2. 1 PublicationVSP_054494Add
BLAST
Alternative sequencei1163 – 1942780Missing in isoform 2. 1 PublicationVSP_054495Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D29677 mRNA. Translation: BAA06147.3. Different initiation.
AC005544 Genomic DNA. No translation available.
AC007448 Genomic DNA. No translation available.
BC094881 mRNA. Translation: AAH94881.1.
CCDSiCCDS42374.1. [P42694-1]
RefSeqiNP_055692.2. NM_014877.3.
UniGeneiHs.370140.
Hs.569824.
Hs.596366.

Genome annotation databases

EnsembliENST00000358691; ENSP00000351524; ENSG00000198265. [P42694-1]
ENST00000579953; ENSP00000463727; ENSG00000198265. [P42694-2]
GeneIDi9931.
KEGGihsa:9931.
UCSCiuc002jfx.5. human. [P42694-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D29677 mRNA. Translation: BAA06147.3. Different initiation.
AC005544 Genomic DNA. No translation available.
AC007448 Genomic DNA. No translation available.
BC094881 mRNA. Translation: AAH94881.1.
CCDSiCCDS42374.1. [P42694-1]
RefSeqiNP_055692.2. NM_014877.3.
UniGeneiHs.370140.
Hs.569824.
Hs.596366.

3D structure databases

ProteinModelPortaliP42694.
SMRiP42694. Positions 642-1054.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP42694. 14 interactions.
MINTiMINT-5005990.
STRINGi9606.ENSP00000351524.

PTM databases

iPTMnetiP42694.
PhosphoSiteiP42694.

Polymorphism and mutation databases

DMDMi221222452.

Proteomic databases

EPDiP42694.
MaxQBiP42694.
PaxDbiP42694.
PRIDEiP42694.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358691; ENSP00000351524; ENSG00000198265. [P42694-1]
ENST00000579953; ENSP00000463727; ENSG00000198265. [P42694-2]
GeneIDi9931.
KEGGihsa:9931.
UCSCiuc002jfx.5. human. [P42694-1]

Organism-specific databases

CTDi9931.
GeneCardsiHELZ.
HGNCiHGNC:16878. HELZ.
HPAiHPA028276.
MIMi606699. gene.
neXtProtiNX_P42694.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1804. Eukaryota.
COG1112. LUCA.
GeneTreeiENSGT00800000124068.
HOVERGENiHBG031603.
InParanoidiP42694.
OrthoDBiEOG7H791D.
PhylomeDBiP42694.
TreeFamiTF323999.

Miscellaneous databases

ChiTaRSiHELZ. human.
GenomeRNAii9931.
PROiP42694.
SOURCEiSearch...

Gene expression databases

BgeeiP42694.
CleanExiHS_HELZ.
ExpressionAtlasiP42694. baseline and differential.
GenevisibleiP42694. HS.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
4.10.1000.10. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR000571. Znf_CCCH.
[Graphical view]
PfamiPF00642. zf-CCCH. 1 hit.
[Graphical view]
SMARTiSM00356. ZnF_C3H1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
SSF90229. SSF90229. 1 hit.
PROSITEiPS50103. ZF_C3H1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1."
    Nomura N., Nagase T., Miyajima N., Sazuka T., Tanaka A., Sato S., Seki N., Kawarabayasi Y., Ishikawa K., Tabata S.
    DNA Res. 1:223-229(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Bone marrow.
  2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Lymph.
  4. "Identification of a differentially expressed RNA helicase by gene trapping."
    Wagner D.S., Gan L., Klein W.H.
    Biochem. Biophys. Res. Commun. 262:677-684(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA], DISCUSSION OF SEQUENCE.
  5. "Down-regulation in human cancers of DRHC, a novel helicase-like gene from 17q25.1 that inhibits cell growth."
    Nagai H., Yabe A., Mine N., Mikami I., Fujiwara H., Terada Y., Hirano A., Tsuneizumi M., Yokota T., Emi M.
    Cancer Lett. 193:41-47(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  6. "SMYD3 encodes a histone methyltransferase involved in the proliferation of cancer cells."
    Hamamoto R., Furukawa Y., Morita M., Iimura Y., Silva F.P., Li M., Yagyu R., Nakamura Y.
    Nat. Cell Biol. 6:731-740(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SMYD3 AND POLR2A.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1738 AND SER-1766, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1614, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiHELZ_HUMAN
AccessioniPrimary (citable) accession number: P42694
Secondary accession number(s): I6L9H4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: January 20, 2009
Last modified: June 8, 2016
This is version 145 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.