P42652 Q8L5E2 14334_SOLLC 14-3-3 protein 4 PBLT4 TFT4 Solanum lycopersicum Tomato Lycopersicon esculentum Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliophyta eudicotyledons core eudicotyledons asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Lycopersicon Two cDNA clones encoding 14-3-3 homologs from tomato fruit. NUCLEOTIDE SEQUENCE [MRNA] cv. Ailsa Craig Fruit Fusicoccin, 14-3-3 proteins, and defense responses in tomato plants. NUCLEOTIDE SEQUENCE [MRNA] cv. Moneymaker Leaf Homodimer (Potential). Belongs to the 14-3-3 family. Complete proteome Reference proteome D E H Y MADSSREENVYLAKLAEQAERYEEMIEFMEKVAKTADVEELTVEERNLLSVAYKNVIGAR RASWRIISSIEQKEESRGNEDHVNTIKEYRSKIEADLSKICDGILSLLESNLIPSASTAE SKVFHLKMKGDYHRYLAEFKTGTERKEAAENTLLAYKSAQDIALAELAPTHPIRLGLALN FSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDNA DDVGDDIKEASKPESGEGQQ Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License