Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P42571

- PO2F3_RAT

UniProt

P42571 - PO2F3_RAT

Protein

POU domain, class 2, transcription factor 3

Gene

Pou2f3

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 117 (01 Oct 2014)
      Sequence version 1 (01 Nov 1995)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Activates cytokeratin 10 (K10) gene expression. May serve a regulatory function with respect to epidermal development. Isoform 2 inhibits transactivation by OCT-1.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi274 – 33360HomeoboxPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. sequence-specific DNA binding Source: InterPro
    2. sequence-specific DNA binding transcription factor activity Source: InterPro

    GO - Biological processi

    1. epidermis development Source: RGD
    2. regulation of transcription from RNA polymerase II promoter Source: RGD
    3. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    POU domain, class 2, transcription factor 3
    Alternative name(s):
    Octamer-binding protein 11
    Short name:
    Oct-11
    Octamer-binding transcription factor 11
    Short name:
    OTF-11
    Transcription factor Skn-1
    Gene namesi
    Name:Pou2f3
    Synonyms:Otf11, Skn-1, Skn1
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi621691. Pou2f3.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 430430POU domain, class 2, transcription factor 3PRO_0000100719Add
    BLAST

    Expressioni

    Tissue specificityi

    Expressed in epidermis.

    Gene expression databases

    GenevestigatoriP42571.

    Interactioni

    Protein-protein interaction databases

    STRINGi10116.ENSRNOP00000012170.

    Structurei

    3D structure databases

    ProteinModelPortaliP42571.
    SMRiP42571. Positions 177-333.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini176 – 25075POU-specificPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi347 – 41973Ser-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation
    Contains 1 POU-specific domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Homeobox

    Phylogenomic databases

    eggNOGiNOG267922.
    HOGENOMiHOG000220842.
    HOVERGENiHBG052783.
    InParanoidiP42571.
    PhylomeDBiP42571.

    Family and domain databases

    Gene3Di1.10.10.60. 1 hit.
    1.10.260.40. 1 hit.
    InterProiIPR017970. Homeobox_CS.
    IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    IPR010982. Lambda_DNA-bd_dom.
    IPR013847. POU.
    IPR000327. POU_specific.
    IPR000972. TF_octamer.
    [Graphical view]
    PfamiPF00046. Homeobox. 1 hit.
    PF00157. Pou. 1 hit.
    [Graphical view]
    PRINTSiPR00029. OCTAMER.
    PR00028. POUDOMAIN.
    SMARTiSM00389. HOX. 1 hit.
    SM00352. POU. 1 hit.
    [Graphical view]
    SUPFAMiSSF46689. SSF46689. 1 hit.
    SSF47413. SSF47413. 1 hit.
    PROSITEiPS00027. HOMEOBOX_1. 1 hit.
    PS50071. HOMEOBOX_2. 1 hit.
    PS00035. POU_1. 1 hit.
    PS00465. POU_2. 1 hit.
    PS51179. POU_3. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P42571-1) [UniParc]FASTAAdd to Basket

    Also known as: Skn-1a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVNLEPMHTE IKMSGDVADS TDARSTFGQV ESGNDRNGLD FNRQIKTEDL    50
    GDTLHESLSH RPCHLTEGPT MMPGNQMSGD MASLHPLQQL VLVPGHLQSV 100
    SQFLLSQTPP GQQGLQPNLL SFPQQQSTLL LPQTGPGLTS QAVGRPGLSG 150
    SSLEPHLEAS QHLPGPKHLP GPGGNDEPTD LEELEKFAKT FKQRRIKLGF 200
    TQGDVGLAMG KLYGNDFSQT TISRFEALNL SFKNMCKLKP LLEKWLNDAE 250
    SSPADPSAST PSSYPTLSEV FGRKRKKRTS IETNIRLTLE KRFQDNPKPS 300
    SEEISMIAEQ LSMEKEVVRV WFCNRRQKEK RINCPVATPV KPPIYNSRLV 350
    SPSGSLGSLS VPPVHSTMPG TVTSSCSPGN NSRPSSPGSG LHASSPTASQ 400
    NNSKAAMNPS SAAFNSSGSW YRWNHPAYLH 430
    Length:430
    Mass (Da):46,814
    Last modified:November 1, 1995 - v1
    Checksum:i9B538CBD9743B96F
    GO
    Isoform 2 (identifier: P42571-2) [UniParc]FASTAAdd to Basket

    Also known as: Skn-1i

    The sequence of this isoform differs from the canonical sequence as follows:
         1-113: MVNLEPMHTE...LLSQTPPGQQ → MVSMFSLSFKWPGFCLFVCLFLCPFVLPCHS

    Show »
    Length:348
    Mass (Da):38,049
    Checksum:i1034090058084B17
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 113113MVNLE…PPGQQ → MVSMFSLSFKWPGFCLFVCL FLCPFVLPCHS in isoform 2. CuratedVSP_002332Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L23862 mRNA. No translation available.
    L23863 mRNA. No translation available.
    PIRiA46216.
    UniGeneiRn.81060.

    Genome annotation databases

    UCSCiRGD:621691. rat. [P42571-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L23862 mRNA. No translation available.
    L23863 mRNA. No translation available.
    PIRi A46216.
    UniGenei Rn.81060.

    3D structure databases

    ProteinModelPortali P42571.
    SMRi P42571. Positions 177-333.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10116.ENSRNOP00000012170.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    UCSCi RGD:621691. rat. [P42571-1 ]

    Organism-specific databases

    RGDi 621691. Pou2f3.

    Phylogenomic databases

    eggNOGi NOG267922.
    HOGENOMi HOG000220842.
    HOVERGENi HBG052783.
    InParanoidi P42571.
    PhylomeDBi P42571.

    Gene expression databases

    Genevestigatori P42571.

    Family and domain databases

    Gene3Di 1.10.10.60. 1 hit.
    1.10.260.40. 1 hit.
    InterProi IPR017970. Homeobox_CS.
    IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    IPR010982. Lambda_DNA-bd_dom.
    IPR013847. POU.
    IPR000327. POU_specific.
    IPR000972. TF_octamer.
    [Graphical view ]
    Pfami PF00046. Homeobox. 1 hit.
    PF00157. Pou. 1 hit.
    [Graphical view ]
    PRINTSi PR00029. OCTAMER.
    PR00028. POUDOMAIN.
    SMARTi SM00389. HOX. 1 hit.
    SM00352. POU. 1 hit.
    [Graphical view ]
    SUPFAMi SSF46689. SSF46689. 1 hit.
    SSF47413. SSF47413. 1 hit.
    PROSITEi PS00027. HOMEOBOX_1. 1 hit.
    PS50071. HOMEOBOX_2. 1 hit.
    PS00035. POU_1. 1 hit.
    PS00465. POU_2. 1 hit.
    PS51179. POU_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Skn-1a and Skn-1i: two functionally distinct Oct-2-related factors expressed in epidermis."
      Andersen B., Schonemann M.D., Flynn S.E., Pearse R.V. II, Singh H., Rosenfeld M.G.
      Science 260:78-82(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
      Strain: Fischer.
      Tissue: Skin.

    Entry informationi

    Entry nameiPO2F3_RAT
    AccessioniPrimary (citable) accession number: P42571
    Secondary accession number(s): P42572
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1995
    Last sequence update: November 1, 1995
    Last modified: October 1, 2014
    This is version 117 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3