Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P42571 (PO2F3_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 116. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
POU domain, class 2, transcription factor 3
Alternative name(s):
Octamer-binding protein 11
Short name=Oct-11
Octamer-binding transcription factor 11
Short name=OTF-11
Transcription factor Skn-1
Gene names
Name:Pou2f3
Synonyms:Otf11, Skn-1, Skn1
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length430 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Activates cytokeratin 10 (K10) gene expression. May serve a regulatory function with respect to epidermal development. Isoform 2 inhibits transactivation by OCT-1.

Subcellular location

Nucleus.

Tissue specificity

Expressed in epidermis.

Sequence similarities

Belongs to the POU transcription factor family. Class-2 subfamily.

Contains 1 homeobox DNA-binding domain.

Contains 1 POU-specific domain.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P42571-1)

Also known as: Skn-1a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P42571-2)

Also known as: Skn-1i;

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: MVNLEPMHTE...LLSQTPPGQQ → MVSMFSLSFKWPGFCLFVCLFLCPFVLPCHS

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 430430POU domain, class 2, transcription factor 3
PRO_0000100719

Regions

Domain176 – 25075POU-specific
DNA binding274 – 33360Homeobox
Compositional bias347 – 41973Ser-rich

Natural variations

Alternative sequence1 – 113113MVNLE…PPGQQ → MVSMFSLSFKWPGFCLFVCL FLCPFVLPCHS in isoform 2.
VSP_002332

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Skn-1a) [UniParc].

Last modified November 1, 1995. Version 1.
Checksum: 9B538CBD9743B96F

FASTA43046,814
        10         20         30         40         50         60 
MVNLEPMHTE IKMSGDVADS TDARSTFGQV ESGNDRNGLD FNRQIKTEDL GDTLHESLSH 

        70         80         90        100        110        120 
RPCHLTEGPT MMPGNQMSGD MASLHPLQQL VLVPGHLQSV SQFLLSQTPP GQQGLQPNLL 

       130        140        150        160        170        180 
SFPQQQSTLL LPQTGPGLTS QAVGRPGLSG SSLEPHLEAS QHLPGPKHLP GPGGNDEPTD 

       190        200        210        220        230        240 
LEELEKFAKT FKQRRIKLGF TQGDVGLAMG KLYGNDFSQT TISRFEALNL SFKNMCKLKP 

       250        260        270        280        290        300 
LLEKWLNDAE SSPADPSAST PSSYPTLSEV FGRKRKKRTS IETNIRLTLE KRFQDNPKPS 

       310        320        330        340        350        360 
SEEISMIAEQ LSMEKEVVRV WFCNRRQKEK RINCPVATPV KPPIYNSRLV SPSGSLGSLS 

       370        380        390        400        410        420 
VPPVHSTMPG TVTSSCSPGN NSRPSSPGSG LHASSPTASQ NNSKAAMNPS SAAFNSSGSW 

       430 
YRWNHPAYLH 

« Hide

Isoform 2 (Skn-1i) [UniParc].

Checksum: 1034090058084B17
Show »

FASTA34838,049

References

[1]"Skn-1a and Skn-1i: two functionally distinct Oct-2-related factors expressed in epidermis."
Andersen B., Schonemann M.D., Flynn S.E., Pearse R.V. II, Singh H., Rosenfeld M.G.
Science 260:78-82(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Strain: Fischer.
Tissue: Skin.
[2]Erratum
Andersen B., Schonemann M.D., Flynn S.E., Pearse R.V. II, Singh H., Rosenfeld M.G.
Science 262:1499-1499(1993) [PubMed] [Europe PMC] [Abstract]

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L23862 mRNA. No translation available.
L23863 mRNA. No translation available.
PIRA46216.
UniGeneRn.81060.

3D structure databases

ProteinModelPortalP42571.
SMRP42571. Positions 177-333.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING10116.ENSRNOP00000012170.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

UCSCRGD:621691. rat. [P42571-1]

Organism-specific databases

RGD621691. Pou2f3.

Phylogenomic databases

eggNOGNOG267922.
HOGENOMHOG000220842.
HOVERGENHBG052783.
InParanoidP42571.
PhylomeDBP42571.

Gene expression databases

GenevestigatorP42571.

Family and domain databases

Gene3D1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
IPR013847. POU.
IPR000327. POU_specific.
IPR000972. TF_octamer.
[Graphical view]
PfamPF00046. Homeobox. 1 hit.
PF00157. Pou. 1 hit.
[Graphical view]
PRINTSPR00029. OCTAMER.
PR00028. POUDOMAIN.
SMARTSM00389. HOX. 1 hit.
SM00352. POU. 1 hit.
[Graphical view]
SUPFAMSSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00035. POU_1. 1 hit.
PS00465. POU_2. 1 hit.
PS51179. POU_3. 1 hit.
[Graphical view]
ProtoNetSearch...

Entry information

Entry namePO2F3_RAT
AccessionPrimary (citable) accession number: P42571
Secondary accession number(s): P42572
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: May 14, 2014
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families