Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

POU domain, class 2, transcription factor 3

Gene

Pou2f3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Activates cytokeratin 10 (K10) gene expression. May serve a regulatory function with respect to epidermal development. Isoform 2 inhibits transactivation by OCT-1.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi274 – 333HomeoboxPROSITE-ProRule annotationAdd BLAST60

GO - Molecular functioni

GO - Biological processi

  • epidermis development Source: RGD
  • regulation of transcription by RNA polymerase II Source: RGD
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
POU domain, class 2, transcription factor 3
Alternative name(s):
Octamer-binding protein 11
Short name:
Oct-11
Octamer-binding transcription factor 11
Short name:
OTF-11
Transcription factor Skn-1
Gene namesi
Name:Pou2f3
Synonyms:Otf11, Skn-1, Skn1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi621691 Pou2f3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001007191 – 430POU domain, class 2, transcription factor 3Add BLAST430

Proteomic databases

PaxDbiP42571
PRIDEiP42571

Expressioni

Tissue specificityi

Expressed in epidermis.

Interactioni

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000012170

Structurei

3D structure databases

ProteinModelPortaliP42571
SMRiP42571
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini176 – 250POU-specificPROSITE-ProRule annotationAdd BLAST75

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi347 – 419Ser-richAdd BLAST73

Sequence similaritiesi

Keywords - Domaini

Homeobox

Phylogenomic databases

eggNOGiKOG3802 Eukaryota
ENOG410XQ7X LUCA
HOGENOMiHOG000220842
HOVERGENiHBG052783
InParanoidiP42571
PhylomeDBiP42571

Family and domain databases

CDDicd00086 homeodomain, 1 hit
cd00093 HTH_XRE, 1 hit
InterProiView protein in InterPro
IPR001387 Cro/C1-type_HTH
IPR009057 Homeobox-like_sf
IPR017970 Homeobox_CS
IPR001356 Homeobox_dom
IPR010982 Lambda_DNA-bd_dom_sf
IPR013847 POU
IPR000327 POU_dom
IPR000972 TF_octamer
PfamiView protein in Pfam
PF00046 Homeobox, 1 hit
PF00157 Pou, 1 hit
PRINTSiPR00029 OCTAMER
PR00028 POUDOMAIN
SMARTiView protein in SMART
SM00389 HOX, 1 hit
SM00352 POU, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit
SSF47413 SSF47413, 1 hit
PROSITEiView protein in PROSITE
PS00027 HOMEOBOX_1, 1 hit
PS50071 HOMEOBOX_2, 1 hit
PS00035 POU_1, 1 hit
PS00465 POU_2, 1 hit
PS51179 POU_3, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P42571-1) [UniParc]FASTAAdd to basket
Also known as: Skn-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVNLEPMHTE IKMSGDVADS TDARSTFGQV ESGNDRNGLD FNRQIKTEDL
60 70 80 90 100
GDTLHESLSH RPCHLTEGPT MMPGNQMSGD MASLHPLQQL VLVPGHLQSV
110 120 130 140 150
SQFLLSQTPP GQQGLQPNLL SFPQQQSTLL LPQTGPGLTS QAVGRPGLSG
160 170 180 190 200
SSLEPHLEAS QHLPGPKHLP GPGGNDEPTD LEELEKFAKT FKQRRIKLGF
210 220 230 240 250
TQGDVGLAMG KLYGNDFSQT TISRFEALNL SFKNMCKLKP LLEKWLNDAE
260 270 280 290 300
SSPADPSAST PSSYPTLSEV FGRKRKKRTS IETNIRLTLE KRFQDNPKPS
310 320 330 340 350
SEEISMIAEQ LSMEKEVVRV WFCNRRQKEK RINCPVATPV KPPIYNSRLV
360 370 380 390 400
SPSGSLGSLS VPPVHSTMPG TVTSSCSPGN NSRPSSPGSG LHASSPTASQ
410 420 430
NNSKAAMNPS SAAFNSSGSW YRWNHPAYLH
Length:430
Mass (Da):46,814
Last modified:November 1, 1995 - v1
Checksum:i9B538CBD9743B96F
GO
Isoform 2 (identifier: P42571-2) [UniParc]FASTAAdd to basket
Also known as: Skn-1i

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: MVNLEPMHTE...LLSQTPPGQQ → MVSMFSLSFKWPGFCLFVCLFLCPFVLPCHS

Show »
Length:348
Mass (Da):38,049
Checksum:i1034090058084B17
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0023321 – 113MVNLE…PPGQQ → MVSMFSLSFKWPGFCLFVCL FLCPFVLPCHS in isoform 2. CuratedAdd BLAST113

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L23862 mRNA No translation available.
L23863 mRNA No translation available.
PIRiA46216
UniGeneiRn.81060

Genome annotation databases

UCSCiRGD:621691 rat [P42571-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPO2F3_RAT
AccessioniPrimary (citable) accession number: P42571
Secondary accession number(s): P42572
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: May 23, 2018
This is version 134 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health