Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

POU domain, class 2, transcription factor 3

Gene

Pou2f3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Activates cytokeratin 10 (K10) gene expression. May serve a regulatory function with respect to epidermal development. Isoform 2 inhibits transactivation by OCT-1.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi274 – 33360HomeoboxPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

  • epidermis development Source: RGD
  • regulation of transcription from RNA polymerase II promoter Source: RGD
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
POU domain, class 2, transcription factor 3
Alternative name(s):
Octamer-binding protein 11
Short name:
Oct-11
Octamer-binding transcription factor 11
Short name:
OTF-11
Transcription factor Skn-1
Gene namesi
Name:Pou2f3
Synonyms:Otf11, Skn-1, Skn1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494 Componenti: Unplaced

Organism-specific databases

RGDi621691. Pou2f3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 430430POU domain, class 2, transcription factor 3PRO_0000100719Add
BLAST

Expressioni

Tissue specificityi

Expressed in epidermis.

Interactioni

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000012170.

Structurei

3D structure databases

ProteinModelPortaliP42571.
SMRiP42571. Positions 177-333.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini176 – 25075POU-specificPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi347 – 41973Ser-richAdd
BLAST

Sequence similaritiesi

Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation
Contains 1 POU-specific domain.PROSITE-ProRule annotation

Keywords - Domaini

Homeobox

Phylogenomic databases

eggNOGiNOG267922.
HOGENOMiHOG000220842.
HOVERGENiHBG052783.
InParanoidiP42571.
PhylomeDBiP42571.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProiIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
IPR013847. POU.
IPR000327. POU_specific.
IPR000972. TF_octamer.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
PF00157. Pou. 1 hit.
[Graphical view]
PRINTSiPR00029. OCTAMER.
PR00028. POUDOMAIN.
SMARTiSM00389. HOX. 1 hit.
SM00352. POU. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEiPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00035. POU_1. 1 hit.
PS00465. POU_2. 1 hit.
PS51179. POU_3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P42571-1) [UniParc]FASTAAdd to basket

Also known as: Skn-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVNLEPMHTE IKMSGDVADS TDARSTFGQV ESGNDRNGLD FNRQIKTEDL
60 70 80 90 100
GDTLHESLSH RPCHLTEGPT MMPGNQMSGD MASLHPLQQL VLVPGHLQSV
110 120 130 140 150
SQFLLSQTPP GQQGLQPNLL SFPQQQSTLL LPQTGPGLTS QAVGRPGLSG
160 170 180 190 200
SSLEPHLEAS QHLPGPKHLP GPGGNDEPTD LEELEKFAKT FKQRRIKLGF
210 220 230 240 250
TQGDVGLAMG KLYGNDFSQT TISRFEALNL SFKNMCKLKP LLEKWLNDAE
260 270 280 290 300
SSPADPSAST PSSYPTLSEV FGRKRKKRTS IETNIRLTLE KRFQDNPKPS
310 320 330 340 350
SEEISMIAEQ LSMEKEVVRV WFCNRRQKEK RINCPVATPV KPPIYNSRLV
360 370 380 390 400
SPSGSLGSLS VPPVHSTMPG TVTSSCSPGN NSRPSSPGSG LHASSPTASQ
410 420 430
NNSKAAMNPS SAAFNSSGSW YRWNHPAYLH
Length:430
Mass (Da):46,814
Last modified:November 1, 1995 - v1
Checksum:i9B538CBD9743B96F
GO
Isoform 2 (identifier: P42571-2) [UniParc]FASTAAdd to basket

Also known as: Skn-1i

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: MVNLEPMHTE...LLSQTPPGQQ → MVSMFSLSFKWPGFCLFVCLFLCPFVLPCHS

Show »
Length:348
Mass (Da):38,049
Checksum:i1034090058084B17
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 113113MVNLE…PPGQQ → MVSMFSLSFKWPGFCLFVCL FLCPFVLPCHS in isoform 2. CuratedVSP_002332Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L23862 mRNA. No translation available.
L23863 mRNA. No translation available.
PIRiA46216.
UniGeneiRn.81060.

Genome annotation databases

UCSCiRGD:621691. rat. [P42571-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L23862 mRNA. No translation available.
L23863 mRNA. No translation available.
PIRiA46216.
UniGeneiRn.81060.

3D structure databases

ProteinModelPortaliP42571.
SMRiP42571. Positions 177-333.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000012170.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

UCSCiRGD:621691. rat. [P42571-1]

Organism-specific databases

RGDi621691. Pou2f3.

Phylogenomic databases

eggNOGiNOG267922.
HOGENOMiHOG000220842.
HOVERGENiHBG052783.
InParanoidiP42571.
PhylomeDBiP42571.

Miscellaneous databases

PROiP42571.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProiIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
IPR013847. POU.
IPR000327. POU_specific.
IPR000972. TF_octamer.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
PF00157. Pou. 1 hit.
[Graphical view]
PRINTSiPR00029. OCTAMER.
PR00028. POUDOMAIN.
SMARTiSM00389. HOX. 1 hit.
SM00352. POU. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEiPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00035. POU_1. 1 hit.
PS00465. POU_2. 1 hit.
PS51179. POU_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Skn-1a and Skn-1i: two functionally distinct Oct-2-related factors expressed in epidermis."
    Andersen B., Schonemann M.D., Flynn S.E., Pearse R.V. II, Singh H., Rosenfeld M.G.
    Science 260:78-82(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Strain: Fischer.
    Tissue: Skin.

Entry informationi

Entry nameiPO2F3_RAT
AccessioniPrimary (citable) accession number: P42571
Secondary accession number(s): P42572
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: November 1, 1995
Last modified: June 24, 2015
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.