P42567 (EPS15_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Epidermal growth factor receptor substrate 15 Short name=Protein Eps15 Alternative name(s): Protein AF-1p | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 897 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in cell growth regulation. May be involved in the regulation of mitogenic signals and control of cell proliferation. Involved in the internalization of ligand-inducible receptors of the receptor tyrosine kinase (RTK) type, in particular EGFR. Plays a role in the assembly of clathrin-coated pits. |
| Subunit structure | Interacts with HGS; the interaction bridges the interaction of STAM or STAM2 with EPS15. Isoform 2 interacts with HGS and AP2A2. Part of a complex at least composed of EPS15, HGS, and either STAM1 or STAM2. Binds AP2A2. Interacts with AP2B1; clathrin competes with EPS15. Binds STON2 and EPN1. Interacts (via its SH3-binding sites) with CRK. Interacts with SH3BP4/TTP. Interacts with ERBB2 By similarity. |
| Subcellular location | Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note: Recruited to the plasma membrane upon EGFR activation and localizes to coated pits. Isoform 2: Early endosome membrane; Peripheral membrane protein; Cytoplasmic side By similarity. Note: Colocalizes with HGS on bilayered clathrin coats on endosomes By similarity. |
| Domain | The EH domain interacts with Asn-Pro-Phe (NPF) motifs of target proteins By similarity. |
| Post-translational modification | Phosphorylated on serine upon DNA damage, probably by ATM or ATR By similarity. Phosphorylation on Tyr-850 is involved in the internalization of EGFR. Not required for membrane translocation after EGF treatment or for targeting to coated pits, but essential for a subsequent step in EGFR endocytosis. Ref.5 Ref.6 Ref.7 |
| Sequence similarities | Contains 2 EF-hand domains. Contains 3 EH domains. Contains 2 UIM (ubiquitin-interacting motif) repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein transport Transport |
| Cellular component | Cell membrane Cytoplasm Endosome Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat SH3-binding |
| Ligand | Calcium |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | protein transport Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | AP-2 adaptor complex Inferred from direct assay. Source: UniProtKB early endosome membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | SH3 domain binding Inferred from electronic annotation. Source: UniProtKB-KW calcium ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Eps15l1 | Q60902 | 2 | EBI-443923,EBI-443931 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P42567-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P42567-2) Also known as: Eps15b; The sequence of this isoform differs from the canonical sequence as follows: 1-314: Missing. 315-346: SLQKNITGSSPVADFSAIKELDTLNNEIVDLQ → MYSDSGLGGWIAIPAVADVLRYSCIVCWSS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 897 | 897 | Epidermal growth factor receptor substrate 15 | PRO_0000146117 | |||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||
| Domain | 15 – 104 | 90 | EH 1 | ||||||||||||||||||||||||
| Domain | 128 – 216 | 89 | EH 2 | ||||||||||||||||||||||||
| Domain | 160 – 195 | 36 | EF-hand 1 | ||||||||||||||||||||||||
| Domain | 223 – 258 | 36 | EF-hand 2 | ||||||||||||||||||||||||
| Domain | 224 – 314 | 91 | EH 3 | ||||||||||||||||||||||||
| Repeat | 599 – 601 | 3 | 1 | ||||||||||||||||||||||||
| Repeat | 623 – 625 | 3 | 2 | ||||||||||||||||||||||||
| Repeat | 629 – 631 | 3 | 3 | ||||||||||||||||||||||||
| Repeat | 634 – 636 | 3 | 4 | ||||||||||||||||||||||||
| Repeat | 640 – 642 | 3 | 5 | ||||||||||||||||||||||||
| Repeat | 645 – 647 | 3 | 6 | ||||||||||||||||||||||||
| Repeat | 651 – 653 | 3 | 7 | ||||||||||||||||||||||||
| Repeat | 665 – 667 | 3 | 8 | ||||||||||||||||||||||||
| Repeat | 673 – 675 | 3 | 9 | ||||||||||||||||||||||||
| Repeat | 693 – 695 | 3 | 10 | ||||||||||||||||||||||||
| Repeat | 711 – 713 | 3 | 11 | ||||||||||||||||||||||||
| Repeat | 806 – 808 | 3 | 12 | ||||||||||||||||||||||||
| Repeat | 827 – 829 | 3 | 13 | ||||||||||||||||||||||||
| Repeat | 852 – 871 | 20 | UIM 1 | ||||||||||||||||||||||||
| Repeat | 878 – 897 | 20 | UIM 2 | ||||||||||||||||||||||||
| Calcium binding | 173 – 184 | 12 | 1 Potential | ||||||||||||||||||||||||
| Calcium binding | 236 – 247 | 12 | 2 Potential | ||||||||||||||||||||||||
| Region | 599 – 829 | 231 | 13 X 3 AA repeats of D-P-F | ||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||
| Modified residue | 106 | 1 | Phosphoserine Ref.6 | ||||||||||||||||||||||||
| Modified residue | 108 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||
| Modified residue | 140 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||
| Modified residue | 323 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||
| Modified residue | 324 | 1 | Phosphoserine Ref.6 | ||||||||||||||||||||||||
| Modified residue | 485 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||
| Modified residue | 561 | 1 | Phosphoserine Ref.6 | ||||||||||||||||||||||||
| Modified residue | 562 | 1 | Phosphoserine Ref.6 | ||||||||||||||||||||||||
| Modified residue | 779 | 1 | Phosphothreonine Ref.7 | ||||||||||||||||||||||||
| Modified residue | 781 | 1 | Phosphothreonine Ref.6 | ||||||||||||||||||||||||
| Modified residue | 798 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||
| Modified residue | 816 | 1 | Phosphoserine Ref.7 | ||||||||||||||||||||||||
| Modified residue | 850 | 1 | Phosphotyrosine; by EGFR Ref.5 | ||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||
| Alternative sequence | 1 – 314 | 314 | Missing in isoform 2. | VSP_036170 | |||||||||||||||||||||||
| Alternative sequence | 315 – 346 | 32 | SLQKN…IVDLQ → MYSDSGLGGWIAIPAVADVL RYSCIVCWSS in isoform 2. | VSP_036171 | |||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||
| Mutagenesis | 850 | 1 | Y → F: Inefficient EGFR internalization. Ref.5 | ||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||
| Helix | 9 – 12 | 4 | |||||||||||||||||||||||||
| Turn | 13 – 15 | 3 | |||||||||||||||||||||||||
| Helix | 18 – 26 | 9 | |||||||||||||||||||||||||
| Helix | 37 – 44 | 8 | |||||||||||||||||||||||||
| Beta strand | 46 – 48 | 3 | |||||||||||||||||||||||||
| Helix | 50 – 60 | 11 | |||||||||||||||||||||||||
| Beta strand | 63 – 67 | 5 | |||||||||||||||||||||||||
| Helix | 71 – 83 | 13 | |||||||||||||||||||||||||
| Turn | 84 – 86 | 3 | |||||||||||||||||||||||||
| Helix | 91 – 93 | 3 | |||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "eps15, a novel tyrosine kinase substrate, exhibits transforming activity." Fazioli F., Minichiello L., Matoskova B., Wong W.T., di Fiore P.P. Mol. Cell. Biol. 13:5814-5828(1993) [PubMed: 7689153] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Fibroblast. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Hippocampus. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | Lubec G., Sunyer B., Chen W.-Q. Submitted (JAN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 838-862, MASS SPECTROMETRY. Strain: OF1. Tissue: Hippocampus. |
| [5] | "Tyrosine phosphorylation of Eps15 is required for ligand-regulated, but not constitutive, endocytosis." Confalonieri S., Salcini A.E., Puri C., Tacchetti C., Di Fiore P.P. J. Cell Biol. 150:905-912(2000) [PubMed: 10953014] [Abstract] Cited for: PHOSPHORYLATION AT TYR-850 BY EGFR, MUTAGENESIS OF TYR-850. |
| [6] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed: 17242355] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-106; SER-324; SER-561; SER-562 AND THR-781, MASS SPECTROMETRY. Tissue: Liver. |
| [7] | "The phagosomal proteome in interferon-gamma-activated macrophages." Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P. Immunity 30:143-154(2009) [PubMed: 19144319] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-779 AND SER-816, MASS SPECTROMETRY. Tissue: Macrophage. |
| [8] | "The EH1 domain of Eps15 is structurally classified as a member of the S100 subclass of EF-hand-containing proteins." Whitehead B., Tessari M., Carotenuto A., van Bergen en Henegouwen P.M., Vuister G.W. Biochemistry 38:11271-11277(1999) [PubMed: 10471276] [Abstract] Cited for: STRUCTURE BY NMR OF 7-105. |
| [9] | "Accessory protein recruitment motifs in clathrin-mediated endocytosis." Brett T.J., Traub L.M., Fremont D.H. Structure 10:797-809(2002) [PubMed: 12057195] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.22 ANGSTROMS) OF 628-632 IN COMPLEX WITH AP2A2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L21768 mRNA. Translation: AAA02912.1. AK083176 mRNA. Translation: BAC38796.1. AL669905 Genomic DNA. Translation: CAM13653.1. | ||||||||||||||||||||||||
| IPI | IPI00117454. IPI00473528. | ||||||||||||||||||||||||
| PIR | A54696. | ||||||||||||||||||||||||
| RefSeq | NP_001153436.1. NM_001159964.1. NP_031969.1. NM_007943.3. | ||||||||||||||||||||||||
| UniGene | Mm.318250. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | P42567. | ||||||||||||||||||||||||
| SMR | P42567. Positions 7-105, 121-215, 217-311, 344-376, 455-486. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-29052N. | ||||||||||||||||||||||||
| IntAct | P42567. 1 interaction. | ||||||||||||||||||||||||
| MINT | MINT-86610. | ||||||||||||||||||||||||
| STRING | P42567. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | P42567. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PRIDE | P42567. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENSMUST00000030281; ENSMUSP00000030281; ENSMUSG00000028552. ENSMUST00000102729; ENSMUSP00000099790; ENSMUSG00000028552. | ||||||||||||||||||||||||
| GeneID | 13858. | ||||||||||||||||||||||||
| KEGG | mmu:13858. | ||||||||||||||||||||||||
| UCSC | uc008ucg.2. mouse. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 2060. | ||||||||||||||||||||||||
| MGI | MGI:104583. Eps15. | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| HOGENOM | HBG714644. | ||||||||||||||||||||||||
| HOVERGEN | HBG005591. | ||||||||||||||||||||||||
| InParanoid | P42567. | ||||||||||||||||||||||||
| OMA | WALCDTK. | ||||||||||||||||||||||||
| OrthoDB | EOG4BRWKB. | ||||||||||||||||||||||||
| PhylomeDB | P42567. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | P42567. | ||||||||||||||||||||||||
| Bgee | P42567. | ||||||||||||||||||||||||
| Genevestigator | P42567. | ||||||||||||||||||||||||
| GermOnline | ENSMUSG00000028552. Mus musculus. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR018249. EF_HAND_2. IPR002048. EF_hand_Ca-bd. IPR000261. EPS15_homology. IPR003903. Ubiquitin-int_motif. [Graphical view] | ||||||||||||||||||||||||
| Gene3D | G3DSA:1.10.238.10. EF-Hand_type. 3 hits. | ||||||||||||||||||||||||
| KO | K12472. | ||||||||||||||||||||||||
| SMART | SM00054. EFh. 4 hits. SM00027. EH. 3 hits. SM00726. UIM. 2 hits. [Graphical view] | ||||||||||||||||||||||||
| PROSITE | PS00018. EF_HAND_1. 2 hits. PS50222. EF_HAND_2. 4 hits. PS50031. EH. 3 hits. PS50330. UIM. 2 hits. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| NextBio | 284734. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | EPS15_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P42567 Secondary accession number(s): Q8C431 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with