Reviewed,
UniProtKB/Swiss-Prot P42566 (EPS15_HUMAN)
Last modified
June 16, 2009.
Version 105.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Epidermal growth factor receptor substrate 15 Short name=Protein Eps15 Alternative name(s): Protein AF-1p | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 896 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Involved in cell growth regulation. May be involved in the regulation of mitogenic signals and control of cell proliferation. Involved in the internalization of ligand-inducible receptors of the receptor tyrosine kinase (RTK) type, in particular EGFR. Plays a role in the assembly of clathrin-coated pits By similarity. |
| Subunit structure | Interacts with HGS; the interaction bridges the interaction of STAM or STAM2 with EPS15. Isoform 2 interacts with HGS and AP2A2. Part of a complex at least composed of EPS15, HGS, and either STAM1 or STAM2. Binds AP2A2 and AP2B1. Binds STON2 and EPN1. Interacts (via its SH3-binding sites) with CRK. Interacts with SH3BP4/TTP. Ref.7 Ref.8 Ref.9 Ref.10 Ref.14 |
| Subcellular location | Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note: Recruited to the plasma membrane upon EGFR activation and localizes to coated pits. Ref.14 Ref.23 Ref.24 Isoform 2: Early endosome membrane; Peripheral membrane protein; Cytoplasmic side. Note: Colocalizes with HGS on bilayered clathrin coats on endosomes. Ref.14 Ref.23 Ref.24 |
| Tissue specificity | Ubiquitously expressed. |
| Domain | The EH domain interacts with Asn-Pro-Phe (NPF) motifs of target proteins. Ref.22 |
| Post-translational modification | Phosphorylation on Tyr-849 is involved in the internalization of EGFR. Not required for membrane translocation after EGF treatment or for targeting to coated pits, but essential for a subsequent step in EGFR endocytosis By similarity. Phosphorylated on serine upon DNA damage, probably by ATM or ATR. |
| Involvement in disease | A chromosomal aberration involving EPS15 is found in acute leukemias. Translocation t(1;11)(p32;q23) with MLL/HRX. The result is a rogue activator protein. |
| Sequence similarities | Contains 2 EF-hand domains. Contains 3 EH domains. Contains 2 UIM (ubiquitin-interacting motif) repeats. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ABL1 | P00519 | 1 | EBI-396684,EBI-375543 | |
| AGFG1 | P52594 | 1 | EBI-396684,EBI-996560 | |
| FYN | P06241 | 1 | EBI-396684,EBI-515315 | |
| GRB2 | P62993 | 1 | EBI-396684,EBI-401755 | |
| NCK1 | P16333 | 1 | EBI-396684,EBI-389883 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P42566-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P42566-2) Also known as: Eps15b; The sequence of this isoform differs from the canonical sequence as follows: 1-314: Missing. 315-346: SLQKNIIGSSPVADFSAIKELDTLNNEIVDLQ → MYLKSDSGLGGWITIPAVADVLKYSCIVCWSS | ||||||
| Note: Colocalizes with HGS on bilayered clathrin coats on endosomes. Ref.14 Ref.23 Ref.24 |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 896 | 896 | Epidermal growth factor receptor substrate 15 | PRO_0000146116 | |||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||
| Domain | 15 – 104 | 90 | EH 1 | ||||||||||||||||||||||||||||||||||||||
| Domain | 128 – 216 | 89 | EH 2 | ||||||||||||||||||||||||||||||||||||||
| Domain | 160 – 195 | 36 | EF-hand 1 | ||||||||||||||||||||||||||||||||||||||
| Domain | 223 – 258 | 36 | EF-hand 2 | ||||||||||||||||||||||||||||||||||||||
| Domain | 224 – 314 | 91 | EH 3 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 599 – 601 | 3 | 1 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 623 – 625 | 3 | 2 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 629 – 631 | 3 | 3 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 634 – 636 | 3 | 4 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 640 – 642 | 3 | 5 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 645 – 647 | 3 | 6 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 651 – 653 | 3 | 7 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 664 – 666 | 3 | 8 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 672 – 674 | 3 | 9 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 692 – 694 | 3 | 10 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 709 – 711 | 3 | 11 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 737 – 739 | 3 | 12 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 798 – 800 | 3 | 13 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 804 – 806 | 3 | 14 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 825 – 827 | 3 | 15 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 851 – 870 | 20 | UIM 1 | ||||||||||||||||||||||||||||||||||||||
| Repeat | 877 – 896 | 20 | UIM 2 | ||||||||||||||||||||||||||||||||||||||
| Calcium binding | 173 – 184 | 12 | 1 | ||||||||||||||||||||||||||||||||||||||
| Calcium binding | 236 – 247 | 12 | 2 | ||||||||||||||||||||||||||||||||||||||
| Region | 599 – 827 | 229 | 15 X 3 AA repeats of D-P-F | ||||||||||||||||||||||||||||||||||||||
| Motif | 768 – 774 | 7 | SH3-binding | ||||||||||||||||||||||||||||||||||||||
| Compositional bias | 768 – 850 | 83 | Pro-rich | ||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 140 | 1 | Phosphoserine Ref.18 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 323 | 1 | Phosphoserine Ref.18 Ref.13 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 324 | 1 | Phosphoserine Ref.16 Ref.17 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 485 | 1 | Phosphoserine Ref.18 Ref.15 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 562 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 563 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 777 | 1 | Phosphothreonine Ref.16 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 779 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 796 | 1 | Phosphoserine Ref.16 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 814 | 1 | Phosphoserine Ref.18 Ref.16 Ref.17 Ref.12 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 849 | 1 | Phosphotyrosine; by EGFR By similarity | ||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 314 | 314 | Missing in isoform 2. | VSP_036168 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 315 – 346 | 32 | SLQKN…IVDLQ → MYLKSDSGLGGWITIPAVAD VLKYSCIVCWSS in isoform 2. | VSP_036169 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 822 | 1 | I → M: dbSNP rs17567. Ref.1 | VAR_016142 | |||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 154 | 1 | V → E: Loss of interaction with STON2 NPF motifs. Ref.24 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 169 | 1 | W → A: Loss of interaction with STON2 NPF motifs. Ref.24 | ||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 446 | 1 | Missing in BX647676. Ref.5 | ||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||
| Helix | 126 – 136 | 11 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 142 – 144 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 148 – 156 | 9 | |||||||||||||||||||||||||||||||||||||||
| Turn | 157 – 159 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 162 – 172 | 11 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 177 – 179 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 182 – 197 | 16 | |||||||||||||||||||||||||||||||||||||||
| Turn | 207 – 209 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 223 – 235 | 13 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 240 – 243 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 245 – 253 | 9 | |||||||||||||||||||||||||||||||||||||||
| Turn | 254 – 256 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 259 – 269 | 11 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 274 – 278 | 5 | |||||||||||||||||||||||||||||||||||||||
| Turn | 279 – 281 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 282 – 293 | 12 | |||||||||||||||||||||||||||||||||||||||
| Turn | 305 – 307 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 723 – 726 | 4 | |||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The human eps15 gene, encoding a tyrosine kinase substrate, is conserved in evolution and maps to 1p31-p32." Wong W.T., Kraus M.H., Carlomagno F., Zelano A., Druck T., Croce C.M., Huebner K., di Fiore P.P. Oncogene 9:1591-1597(1994) [PubMed: 8183552] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT MET-822. Tissue: Melanoma. |
| [2] | "A novel gene, AF-1p, fused to HRX in t(1;11)(p32;q23), is not related to AF-4, AF-9 nor ENL." Bernard O.A., Mauchauffe M., Mecucci C., van den Berghe H., Berger R. Oncogene 9:1039-1045(1994) [PubMed: 8134107] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Trachea. |
| [4] | "Eps15 in human umbilical vein endothelial cells." Kronstein R., Grossklaus S., Schnittler H.-J. Submitted (JAN-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Blocker H., Heubner D., Hoerlein A., Michel G., Wedler H., Kohrer K., Ottenwalder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "Interaction between the amino-terminal SH3 domain of CRK and its natural target proteins." Matsuda M., Ota S., Tanimura R., Nakamura H., Matuoka K., Takenawa T., Nagashima K., Kurata T. J. Biol. Chem. 271:14468-14472(1996) [PubMed: 8662907] [Abstract] Cited for: INTERACTION WITH CRK. |
| [8] | "Epsin is an EH-domain-binding protein implicated in clathrin-mediated endocytosis." Chen H., Fre S., Slepnev V.I., Capua M.R., Takei K., Butler M.H., Di Fiore P.P., De Camilli P. Nature 394:793-797(1998) [PubMed: 9723620] [Abstract] Cited for: INTERACTION WITH EPN1. |
| [9] | "STAM and Hrs are subunits of a multivalent ubiquitin-binding complex on early endosomes." Bache K.G., Raiborg C., Mehlum A., Stenmark H. J. Biol. Chem. 278:12513-12521(2003) [PubMed: 12551915] [Abstract] Cited for: INTERACTION WITH HGS AND STAM2. |
| [10] | "TTP specifically regulates the internalization of the transferrin receptor." Tosoni D., Puri C., Confalonieri S., Salcini A.E., De Camilli P., Tacchetti C., Di Fiore P.P. Cell 123:875-888(2005) [PubMed: 16325581] [Abstract] Cited for: INTERACTION WITH SH3BP4. |
| [11] | "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules." Zhang Y., Wolf-Yadlin A., Ross P.L., Pappin D.J., Rush J., Lauffenburger D.A., White F.M. Mol. Cell. Proteomics 4:1240-1250(2005) [PubMed: 15951569] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-849, MASS SPECTROMETRY. Tissue: Epithelium. |
| [12] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-814, MASS SPECTROMETRY. Tissue: Epithelium. |
| [13] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-323, MASS SPECTROMETRY. Tissue: Epithelium. |
| [14] | "An endosomally localized isoform of Eps15 interacts with Hrs to mediate degradation of epidermal growth factor receptor." Roxrud I., Raiborg C., Pedersen N.M., Stang E., Stenmark H. J. Cell Biol. 180:1205-1218(2008) [PubMed: 18362181] [Abstract] Cited for: FUNCTION, ALTERNATIVE SPLICING (ISOFORM 2), SUBCELLULAR LOCATION (ISOFORM 2), INTERACTION WITH HSG AND AP2A2. |
| [15] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed: 17525332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-485, MASS SPECTROMETRY. |
| [16] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed: 18088087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324; THR-777; SER-796 AND SER-814, MASS SPECTROMETRY. Tissue: Platelet. |
| [17] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324 AND SER-814, MASS SPECTROMETRY. |
| [18] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-140; SER-323; SER-485 AND SER-814, MASS SPECTROMETRY. |
| [19] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [20] | "Structure and Asn-Pro-Phe binding pocket of the Eps15 homology domain." de Beer T., Carter R.E., Lobel-Rice K.E., Sorkin A., Overduin M. Science 281:1357-1360(1998) [PubMed: 9721102] [Abstract] Cited for: STRUCTURE BY NMR OF 121-215 IN COMPLEX WITH CALCIUM IONS. |
| [21] | "Solution structure of Eps15's third EH domain reveals coincident Phe-Trp and Asn-Pro-Phe binding sites." Enmon J.L., de Beer T., Overduin M. Biochemistry 39:4309-4319(2000) [PubMed: 10757979] [Abstract] Cited for: STRUCTURE BY NMR OF 217-311 IN COMPLEX WITH CALCIUM IONS. |
| [22] | "Molecular mechanism of NPF recognition by EH domains." de Beer T., Hoofnagle A.N., Enmon J.L., Bowers R.C., Yamabhai M., Kay B.K., Overduin M. Nat. Struct. Biol. 7:1018-1022(2000) [PubMed: 11062555] [Abstract] Cited for: STRUCTURE BY NMR OF 121-215 IN COMPLEX WITH PEPTIDE LIGAND AND CALCIUM IONS, DOMAIN. |
| [23] | "Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly." Schmid E.M., Ford M.G., Burtey A., Praefcke G.J.K., Peak-Chew S.-Y., Mills I.G., Benmerah A., McMahon H.T. PLoS Biol. 4:E262-E262(2006) [PubMed: 16903783] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 719-730 IN COMPLEX WITH AP2B1, MASS SPECTROMETRY, IDENTIFICATION IN A COMPLEX WITH AP2, SUBCELLULAR LOCATION, FUNCTION. |
| [24] | "Structure of the Eps15-stonin2 complex provides a molecular explanation for EH-domain ligand specificity." Rumpf J., Simon B., Jung N., Maritzen T., Haucke V., Sattler M., Groemping Y. EMBO J. 27:558-569(2008) [PubMed: 18200045] [Abstract] Cited for: STRUCTURE BY NMR OF 121-215 IN COMPLEX WITH STON2 AND CALCIUM IONS, MUTAGENESIS OF VAL-154 AND TRP-169, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U07707 mRNA. Translation: AAA52101.1. Z29064 mRNA. Translation: CAA82305.1. AK313396 mRNA. Translation: BAG36194.1. DQ367924 mRNA. Translation: ABD34786.1. BX647676 mRNA. No translation available. AL671986, AC104170 Genomic DNA. Translation: CAI13030.1. | |||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00292134. IPI00916208. | ||||||||||||||||||||||||||||||||||||||||||
| PIR | S43074. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001972.1. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.83722 | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||
| SMR | P42566. Positions 7-105. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| IntAct | P42566. 7 interactions. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P42566. | ||||||||||||||||||||||||||||||||||||||||||
2-D gel databases | |||||||||||||||||||||||||||||||||||||||||||
| OGP | P42566. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PeptideAtlas | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P42566. | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSG00000085832. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 2060. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:2060. | ||||||||||||||||||||||||||||||||||||||||||
| NMPDR | fig|9606.3.peg.1148. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC01M051532. | ||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0000572. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:3419. EPS15. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB010164. HPA008451. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 600051. gene. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA27838. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | P42566. IKGIDPP. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_9417. Signaling by EGFR. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_EPS15. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000085832. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR011992. EF-Hand_type. IPR018247. EF_HAND_1. IPR018249. EF_HAND_2. IPR002048. EF_hand_Ca_bd. IPR000261. EPS15_homology. IPR003903. Ubiquitin-int_motif. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.10.238.10. EF-Hand_type. 3 hits. | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00054. EFh. 3 hits. SM00027. EH. 3 hits. SM00726. UIM. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00018. EF_HAND_1. 2 hits. PS50222. EF_HAND_2. 4 hits. PS50031. EH. 3 hits. PS50330. UIM. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||
| NextBio | 8377. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | EPS15_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P42566 Secondary accession number(s): B2R8J7, Q5SRH4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


