P42566 (EPS15_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 148.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Epidermal growth factor receptor substrate 15 Short name=Protein Eps15 Alternative name(s): Protein AF-1p | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 896 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in cell growth regulation. May be involved in the regulation of mitogenic signals and control of cell proliferation. Involved in the internalization of ligand-inducible receptors of the receptor tyrosine kinase (RTK) type, in particular EGFR. Plays a role in the assembly of clathrin-coated pits (CCPs). Seems to be involved in CCPs maturation including invagination or budding. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR); internalization of ITGB1 as DAB2-dependent cargo but not TFR seems to require association with DAB2. Ref.15 Ref.19 Ref.26 Ref.31 |
| Subunit structure | Interacts with SGIP1 By similarity. Interacts with HGS; the interaction bridges the interaction of STAM or STAM2 with EPS15. Isoform 2 interacts with HGS and AP2A2. Part of a complex at least composed of EPS15, HGS, and either STAM1 or STAM2. Binds AP2A2. Interacts with AP2B1; clathrin competes with EPS15. Binds STON2 and EPN1. Interacts (via its SH3-binding sites) with CRK. Interacts with SH3BP4/TTP. Interacts with ERBB2. Interacts with FCHO1. Interacts with FCHO2. Interacts (via EH domains) with DAB2. Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.15 Ref.22 Ref.24 Ref.26 Ref.27 |
| Subcellular location | Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Membrane › clathrin-coated pit. Note: Recruited to the plasma membrane upon EGFR activation and localizes to coated pits. Ref.15 Ref.31 Ref.32 Isoform 2: Early endosome membrane; Peripheral membrane protein; Cytoplasmic side. Note: Colocalizes with HGS on bilayered clathrin coats on endosomes. Ref.15 Ref.31 Ref.32 |
| Tissue specificity | Ubiquitously expressed. |
| Domain | The EH domain interacts with Asn-Pro-Phe (NPF) motifs of target proteins. Ref.30 |
| Post-translational modification | Phosphorylation on Tyr-849 is involved in the internalization of EGFR. Not required for membrane translocation after EGF treatment or for targeting to coated pits, but essential for a subsequent step in EGFR endocytosis By similarity. Phosphorylated on serine upon DNA damage, probably by ATM or ATR. |
| Involvement in disease | A chromosomal aberration involving EPS15 is found in acute leukemias. Translocation t(1;11)(p32;q23) with MLL/HRX. The result is a rogue activator protein. |
| Sequence similarities | Contains 2 EF-hand domains. Contains 3 EH domains. Contains 2 UIM (ubiquitin-interacting motif) repeats. |
| Caution | Studies in clathrin-mediated endocytosis of ITGB1 and TFR used a siRNA mixture of EPS15 and EPS15L1, and a Dab2 mutant with impaired binding to EH domain-containing proteins EPS15 and ITSN1 suggesting a partially overlapping role of the EH domain-containing proteins (Ref.26). |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| FCHO2 | Q0JRZ9 | 3 | EBI-396684,EBI-2609756 | |
| Fcho2 | Q3UQN2 | 3 | EBI-396684,EBI-6094986 | From a different organism. |
| NCK1 | P16333 | 2 | EBI-396684,EBI-389883 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P42566-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P42566-2) Also known as: Eps15b; The sequence of this isoform differs from the canonical sequence as follows: 1-314: Missing. 315-346: SLQKNIIGSSPVADFSAIKELDTLNNEIVDLQ → MYLKSDSGLGGWITIPAVADVLKYSCIVCWSS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 896 | 896 | Epidermal growth factor receptor substrate 15 | PRO_0000146116 | |||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 15 – 104 | 90 | EH 1 | ||||||||||||||||||||||||||||||||||||||||
| Domain | 128 – 216 | 89 | EH 2 | ||||||||||||||||||||||||||||||||||||||||
| Domain | 160 – 195 | 36 | EF-hand 1 | ||||||||||||||||||||||||||||||||||||||||
| Domain | 223 – 258 | 36 | EF-hand 2 | ||||||||||||||||||||||||||||||||||||||||
| Domain | 224 – 314 | 91 | EH 3 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 599 – 601 | 3 | 1 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 623 – 625 | 3 | 2 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 629 – 631 | 3 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 634 – 636 | 3 | 4 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 640 – 642 | 3 | 5 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 645 – 647 | 3 | 6 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 651 – 653 | 3 | 7 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 664 – 666 | 3 | 8 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 672 – 674 | 3 | 9 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 692 – 694 | 3 | 10 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 709 – 711 | 3 | 11 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 737 – 739 | 3 | 12 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 798 – 800 | 3 | 13 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 804 – 806 | 3 | 14 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 825 – 827 | 3 | 15 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 851 – 870 | 20 | UIM 1 | ||||||||||||||||||||||||||||||||||||||||
| Repeat | 877 – 896 | 20 | UIM 2 | ||||||||||||||||||||||||||||||||||||||||
| Calcium binding | 173 – 184 | 12 | 1 | ||||||||||||||||||||||||||||||||||||||||
| Calcium binding | 236 – 247 | 12 | 2 | ||||||||||||||||||||||||||||||||||||||||
| Region | 2 – 330 | 329 | Interaction with DAB2 By similarity | ||||||||||||||||||||||||||||||||||||||||
| Region | 599 – 827 | 229 | 15 X 3 AA repeats of D-P-F | ||||||||||||||||||||||||||||||||||||||||
| Motif | 768 – 774 | 7 | SH3-binding | ||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 768 – 850 | 83 | Pro-rich | ||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 108 | 1 | Phosphoserine Ref.20 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 140 | 1 | Phosphoserine Ref.18 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 323 | 1 | Phosphoserine Ref.13 Ref.18 Ref.20 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 324 | 1 | Phosphoserine Ref.20 Ref.21 Ref.25 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 467 | 1 | Phosphoserine Ref.21 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 470 | 1 | Phosphoserine Ref.21 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 485 | 1 | Phosphoserine Ref.14 Ref.18 Ref.25 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 562 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 563 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 777 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 779 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 790 | 1 | Phosphoserine Ref.21 Ref.25 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 796 | 1 | Phosphoserine Ref.16 Ref.21 Ref.25 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 814 | 1 | Phosphoserine Ref.16 Ref.18 Ref.20 Ref.21 Ref.25 | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 849 | 1 | Phosphotyrosine; by EGFR Ref.20 | ||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 314 | 314 | Missing in isoform 2. | VSP_036168 | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 315 – 346 | 32 | SLQKN…IVDLQ → MYLKSDSGLGGWITIPAVAD VLKYSCIVCWSS in isoform 2. | VSP_036169 | |||||||||||||||||||||||||||||||||||||||
| Natural variant | 822 | 1 | I → M. Ref.1 Corresponds to variant rs17567 [ dbSNP | Ensembl ]. | VAR_016142 | |||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 154 | 1 | V → E: Loss of interaction with STON2 NPF motifs. Ref.32 | ||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 169 | 1 | W → A: Loss of interaction with STON2 NPF motifs. Ref.32 | ||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 446 | 1 | Missing in BX647676. Ref.5 | ||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 126 – 136 | 11 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 142 – 144 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 145 – 147 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 148 – 156 | 9 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 157 – 159 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 162 – 172 | 11 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 177 – 179 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 182 – 197 | 16 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 207 – 209 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 212 – 214 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 223 – 235 | 13 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 240 – 243 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 245 – 253 | 9 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 254 – 256 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 259 – 269 | 11 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 274 – 278 | 5 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 279 – 281 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 282 – 293 | 12 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 305 – 307 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 723 – 726 | 4 | |||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The human eps15 gene, encoding a tyrosine kinase substrate, is conserved in evolution and maps to 1p31-p32." Wong W.T., Kraus M.H., Carlomagno F., Zelano A., Druck T., Croce C.M., Huebner K., di Fiore P.P. Oncogene 9:1591-1597(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT MET-822. Tissue: Melanoma. |
| [2] | "A novel gene, AF-1p, fused to HRX in t(1;11)(p32;q23), is not related to AF-4, AF-9 nor ENL." Bernard O.A., Mauchauffe M., Mecucci C., van den Berghe H., Berger R. Oncogene 9:1039-1045(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Trachea. |
| [4] | "Eps15 in human umbilical vein endothelial cells." Kronstein R., Grossklaus S., Schnittler H.-J. Submitted (JAN-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "Interaction between the amino-terminal SH3 domain of CRK and its natural target proteins." Matsuda M., Ota S., Tanimura R., Nakamura H., Matuoka K., Takenawa T., Nagashima K., Kurata T. J. Biol. Chem. 271:14468-14472(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CRK. |
| [9] | "Epsin is an EH-domain-binding protein implicated in clathrin-mediated endocytosis." Chen H., Fre S., Slepnev V.I., Capua M.R., Takei K., Butler M.H., Di Fiore P.P., De Camilli P. Nature 394:793-797(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EPN1. |
| [10] | "STAM and Hrs are subunits of a multivalent ubiquitin-binding complex on early endosomes." Bache K.G., Raiborg C., Mehlum A., Stenmark H. J. Biol. Chem. 278:12513-12521(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HGS AND STAM2. |
| [11] | "TTP specifically regulates the internalization of the transferrin receptor." Tosoni D., Puri C., Confalonieri S., Salcini A.E., De Camilli P., Tacchetti C., Di Fiore P.P. Cell 123:875-888(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SH3BP4. |
| [12] | "Endosomal transport of ErbB-2: mechanism for nuclear entry of the cell surface receptor." Giri D.K., Ali-Seyed M., Li L.Y., Lee D.F., Ling P., Bartholomeusz G., Wang S.C., Hung M.C. Mol. Cell. Biol. 25:11005-11018(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ERBB2. |
| [13] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-323, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-485, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [15] | "An endosomally localized isoform of Eps15 interacts with Hrs to mediate degradation of epidermal growth factor receptor." Roxrud I., Raiborg C., Pedersen N.M., Stang E., Stenmark H. J. Cell Biol. 180:1205-1218(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, ALTERNATIVE SPLICING (ISOFORM 2), SUBCELLULAR LOCATION (ISOFORM 2), INTERACTION WITH HSG AND AP2A2. |
| [16] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-796 AND SER-814, MASS SPECTROMETRY. Tissue: Platelet. |
| [17] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [18] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-140; SER-323; SER-485 AND SER-814, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [19] | "Endocytic accessory proteins are functionally distinguished by their differential effects on the maturation of clathrin-coated pits." Mettlen M., Stoeber M., Loerke D., Antonescu C.N., Danuser G., Schmid S.L. Mol. Biol. Cell 20:3251-3260(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [20] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-108; SER-323; SER-324; SER-814 AND TYR-849, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [21] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324; SER-467; SER-470; SER-790; SER-796 AND SER-814, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [22] | "FCHo proteins are nucleators of clathrin-mediated endocytosis." Henne W.M., Boucrot E., Meinecke M., Evergren E., Vallis Y., Mittal R., McMahon H.T. Science 328:1281-1284(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FCHO2. |
| [23] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [24] | "Characterization of the EFC/F-BAR domain protein, FCHO2." Uezu A., Umeda K., Tsujita K., Suetsugu S., Takenawa T., Nakanishi H. Genes Cells 16:868-878(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FCHO2. |
| [25] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324; SER-485; SER-790; SER-796 AND SER-814, MASS SPECTROMETRY. |
| [26] | "The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin beta1 endocytosis." Teckchandani A., Mulkearns E.E., Randolph T.W., Toida N., Cooper J.A. Mol. Biol. Cell 23:2905-2916(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH DAB2. |
| [27] | "Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning." Umasankar P.K., Sanker S., Thieman J.R., Chakraborty S., Wendland B., Tsang M., Traub L.M. Nat. Cell Biol. 14:488-501(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FCHO1. |
| [28] | "Structure and Asn-Pro-Phe binding pocket of the Eps15 homology domain." de Beer T., Carter R.E., Lobel-Rice K.E., Sorkin A., Overduin M. Science 281:1357-1360(1998) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 121-215 IN COMPLEX WITH CALCIUM IONS. |
| [29] | "Solution structure of Eps15's third EH domain reveals coincident Phe-Trp and Asn-Pro-Phe binding sites." Enmon J.L., de Beer T., Overduin M. Biochemistry 39:4309-4319(2000) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 217-311 IN COMPLEX WITH CALCIUM IONS. |
| [30] | "Molecular mechanism of NPF recognition by EH domains." de Beer T., Hoofnagle A.N., Enmon J.L., Bowers R.C., Yamabhai M., Kay B.K., Overduin M. Nat. Struct. Biol. 7:1018-1022(2000) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 121-215 IN COMPLEX WITH PEPTIDE LIGAND AND CALCIUM IONS, DOMAIN. |
| [31] | "Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly." Schmid E.M., Ford M.G.J., Burtey A., Praefcke G.J.K., Peak-Chew S.-Y., Mills I.G., Benmerah A., McMahon H.T. PLoS Biol. 4:E262-E262(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 719-730 IN COMPLEX WITH AP2B1, MASS SPECTROMETRY, SUBCELLULAR LOCATION, FUNCTION. |
| [32] | "Structure of the Eps15-stonin2 complex provides a molecular explanation for EH-domain ligand specificity." Rumpf J., Simon B., Jung N., Maritzen T., Haucke V., Sattler M., Groemping Y. EMBO J. 27:558-569(2008) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 121-215 IN COMPLEX WITH STON2 AND CALCIUM IONS, MUTAGENESIS OF VAL-154 AND TRP-169, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U07707 mRNA. Translation: AAA52101.1. Z29064 mRNA. Translation: CAA82305.1. AK313396 mRNA. Translation: BAG36194.1. DQ367924 mRNA. Translation: ABD34786.1. BX647676 mRNA. No translation available. AL671986, AC104170 Genomic DNA. Translation: CAI13030.1. CH471059 Genomic DNA. Translation: EAX06823.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00292134. IPI00916208. | ||||||||||||||||||||||||||||||||||||||||||
| PIR | S43074. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001153441.1. NM_001159969.1. NP_001972.1. NM_001981.2. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.83722. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-33064N. | ||||||||||||||||||||||||||||||||||||||||||
| IntAct | P42566. 33 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-107223. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000360798. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P42566. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 67476728. | ||||||||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||||||||
| OGP | P42566. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| PeptideAtlas | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P42566. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000371733; ENSP00000360798; ENSG00000085832. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 2060. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:2060. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001csp.3. human. uc001csq.1. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 2060. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC01M051819. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:3419. EPS15. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB010164. HPA008451. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 600051. gene. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P42566. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA27838. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG301764. | ||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000004804. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG005591. | ||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K12472. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | FCDPFTS. | ||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4BRWKB. | ||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P42566. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_116125. Disease. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_EPS15. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000085832. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 1.10.238.10. 3 hits. | ||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR002048. EF_hand_dom. IPR000261. EPS15_homology. IPR003903. Ubiquitin-int_motif. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00054. EFh. 3 hits. SM00027. EH. 3 hits. SM00726. UIM. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00018. EF_HAND_1. 2 hits. PS50222. EF_HAND_2. 4 hits. PS50031. EH. 3 hits. PS50330. UIM. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | EPS15. human. | ||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P42566. | ||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 2060. | ||||||||||||||||||||||||||||||||||||||||||
| NextBio | 8377. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | EPS15_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P42566 Secondary accession number(s): B2R8J7, D3DPJ2, Q5SRH4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
