P42357 (HUTH_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 122.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Histidine ammonia-lyase Short name=Histidase EC=4.3.1.3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 657 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Catalytic activity | L-histidine = urocanate + NH3. |
| Pathway | |
| Post-translational modification | Contains an active site 4-methylidene-imidazol-5-one (MIO), which is formed autocatalytically by cyclization and dehydration of residues Ala-Ser-Gly By similarity. |
| Involvement in disease | Histidinemia (HISTID) [MIM:235800]: Autosomal recessive disease characterized by increased histidine and histamine as well as decreased urocanic acid in body fluids. |
| Sequence similarities | Belongs to the PAL/histidase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Histidine metabolism |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Molecular function | Lyase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | biosynthetic process Inferred from electronic annotation. Source: InterPro histidine catabolic processTraceable author statement. Source: Reactome histidine catabolic process to glutamate and formamideInferred from electronic annotation. Source: UniProtKB-UniPathway histidine catabolic process to glutamate and formateInferred from electronic annotation. Source: UniProtKB-UniPathway |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | histidine ammonia-lyase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P42357-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P42357-2) The sequence of this isoform differs from the canonical sequence as follows: 589-657: PWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKIPESEDL → FGK | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P42357-3) The sequence of this isoform differs from the canonical sequence as follows: 1-208: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 657 | 657 | Histidine ammonia-lyase | PRO_0000161058 | |||||||
Amino acid modifications | |||||||||||
| Modified residue | 254 | 1 | 2,3-didehydroalanine (Ser) By similarity | ||||||||
| Modified residue | 631 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 635 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 648 | 1 | Phosphoserine By similarity | ||||||||
| Cross-link | 253 ↔ 255 | 5-imidazolinone (Ala-Gly) By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 208 | 208 | Missing in isoform 3. | VSP_046003 | |||||||
| Alternative sequence | 589 – 657 | 69 | PWIKD…ESEDL → FGK in isoform 2. | VSP_044704 | |||||||
| Natural variant | 206 | 1 | R → T in HISTID. Ref.7 | VAR_022915 | |||||||
| Natural variant | 208 | 1 | R → L in HISTID. Ref.7 | VAR_022916 | |||||||
| Natural variant | 259 | 1 | P → L in HISTID. Ref.7 | VAR_022917 | |||||||
| Natural variant | 322 | 1 | R → P in HISTID. Ref.7 | VAR_022918 | |||||||
| Natural variant | 439 | 1 | V → I. Ref.2 Ref.3 Ref.5 Ref.6 Corresponds to variant rs7297245 [ dbSNP | Ensembl ]. | VAR_006042 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 549 | 1 | V → M in BAG64570. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of a cDNA encoding human histidase." Suchi M., Harada N., Wada Y., Takagi Y. Biochim. Biophys. Acta 1216:293-295(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [2] | "Molecular cloning and structural characterization of the human histidase gene (HAL)." Suchi M., Sano H., Mizuno H., Wada Y. Genomics 29:98-104(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ILE-439. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT ILE-439. Tissue: Thymus. |
| [4] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ILE-439. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ILE-439. |
| [7] | "Molecular characterization of histidinemia: identification of four missense mutations in the histidase gene." Kawai Y., Moriyama A., Asai K., Coleman-Campbell C.M., Sumi S., Morishita H., Suchi M. Hum. Genet. 116:340-346(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HISTID THR-206; LEU-208; LEU-259 AND PRO-322. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D16626 mRNA. Translation: BAA04047.1. AB042217 Genomic DNA. Translation: BAB61863.1. AK298736 mRNA. Translation: BAG60883.1. AK303544 mRNA. Translation: BAG64570.1. AC007298 Genomic DNA. No translation available. AC126174 Genomic DNA. No translation available. CH471054 Genomic DNA. Translation: EAW97556.1. BC096097 mRNA. Translation: AAH96097.1. BC096098 mRNA. Translation: AAH96098.1. BC096099 mRNA. Translation: AAH96099.1. |
| IPI | IPI00031425. IPI01012806. IPI01015439. |
| PIR | S43415. |
| RefSeq | NP_001245262.1. NM_001258333.1. NP_001245263.1. NM_001258334.1. NP_002099.1. NM_002108.3. |
| UniGene | Hs.190783. Hs.742210. |
3D structure databases | |
| ProteinModelPortal | P42357. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000261208. |
PTM databases | |
| PhosphoSite | P42357. |
Polymorphism databases | |
| DMDM | 1170423. |
Proteomic databases | |
| PaxDb | P42357. |
| PRIDE | P42357. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000261208; ENSP00000261208; ENSG00000084110. ENST00000538703; ENSP00000440861; ENSG00000084110. ENST00000541929; ENSP00000446364; ENSG00000084110. |
| GeneID | 3034. |
| KEGG | hsa:3034. |
| UCSC | uc001tem.1. human. |
Organism-specific databases | |
| CTD | 3034. |
| GeneCards | GC12M096366. |
| HGNC | HGNC:4806. HAL. |
| HPA | HPA038547. HPA038548. |
| MIM | 235800. phenotype. 609457. gene. |
| neXtProt | NX_P42357. |
| Orphanet | 2157. Histidinemia. |
| PharmGKB | PA29181. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2986. |
| HOGENOM | HOG000237619. |
| HOVERGEN | HBG004509. |
| InParanoid | P42357. |
| KO | K01745. |
| OMA | FLRPLKT. |
| OrthoDB | EOG4MW85M. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS01466-MONOMER. |
| Reactome | REACT_111217. Metabolism. |
| UniPathway | UPA00379; UER00549. |
Gene expression databases | |
| ArrayExpress | P42357. |
| Bgee | P42357. |
| CleanEx | HS_HAL. |
| Genevestigator | P42357. |
| GermOnline | ENSG00000084110. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.275.10. 1 hit. |
| InterPro | IPR001106. Aromatic_Lyase. IPR024083. Fumarase/histidase_N. IPR005921. HutH. IPR008948. L-Aspartase-like. IPR022313. Phe/His_NH3-lyase_AS. [Graphical view] |
| Pfam | PF00221. Lyase_aromatic. 1 hit. [Graphical view] |
| SUPFAM | SSF48557. L-Aspartase-like. 1 hit. |
| TIGRFAMs | TIGR01225. hutH. 1 hit. |
| PROSITE | PS00488. PAL_HISTIDASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL4003. |
| DrugBank | DB00117. L-Histidine. |
| GenomeRNAi | 3034. |
| NextBio | 12010. |
| SOURCE | Search... |
Entry information
| Entry name | HUTH_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P42357 Secondary accession number(s): B4DQC1 Q4VB93 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
