Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P42263

- GRIA3_HUMAN

UniProt

P42263 - GRIA3_HUMAN

Protein

Glutamate receptor 3

Gene

GRIA3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 151 (01 Oct 2014)
      Sequence version 2 (11 Oct 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei480 – 4801GlutamateBy similarity
    Binding sitei515 – 5151GlutamateBy similarity
    Binding sitei737 – 7371GlutamateBy similarity

    GO - Molecular functioni

    1. alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity Source: UniProtKB
    2. extracellular-glutamate-gated ion channel activity Source: RefGenome

    GO - Biological processi

    1. glutamate receptor signaling pathway Source: ProtInc
    2. ionotropic glutamate receptor signaling pathway Source: GOC
    3. ion transmembrane transport Source: GOC
    4. synaptic transmission Source: Reactome
    5. synaptic transmission, glutamatergic Source: RefGenome
    6. transport Source: ProtInc

    Keywords - Molecular functioni

    Ion channel, Ligand-gated ion channel, Receptor

    Keywords - Biological processi

    Ion transport, Transport

    Enzyme and pathway databases

    ReactomeiREACT_18307. Trafficking of AMPA receptors.
    REACT_18338. Activation of AMPA receptors.
    REACT_18422. Trafficking of GluR2-containing AMPA receptors.
    REACT_20594. Unblocking of NMDA receptor, glutamate binding and activation.
    SignaLinkiP42263.

    Protein family/group databases

    TCDBi1.A.10.1.4. the glutamate-gated ion channel (gic) family of neurotransmitter receptors.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Glutamate receptor 3
    Short name:
    GluR-3
    Alternative name(s):
    AMPA-selective glutamate receptor 3
    GluR-C
    GluR-K3
    Glutamate receptor ionotropic, AMPA 3
    Short name:
    GluA3
    Gene namesi
    Name:GRIA3
    Synonyms:GLUR3, GLURC
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:4573. GRIA3.

    Subcellular locationi

    Cell membrane; Multi-pass membrane protein. Cell junctionsynapsepostsynaptic cell membrane; Multi-pass membrane protein
    Note: Interaction with CNIH2 and CNIH3 promotes cell surface expression.By similarity

    GO - Cellular componenti

    1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: UniProtKB
    2. cell junction Source: UniProtKB-KW
    3. dendrite Source: RefGenome
    4. endocytic vesicle membrane Source: Reactome
    5. plasma membrane Source: Reactome
    6. postsynaptic membrane Source: RefGenome

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Involvement in diseasei

    Mental retardation, X-linked 94 (MRX94) [MIM:300699]: A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. Intellectual deficiency is the only primary symptom of non-syndromic X-linked mental retardation, while syndromic mental retardation presents with associated physical, neurological and/or psychiatric manifestations. MRX94 patients have moderate mental retardation. Other variable features are macrocephaly, seizures, myoclonic jerks, autistic behavior, asthenic body habitus, distal muscle weakness and hyporeflexia.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti450 – 4501R → Q in MRX94. 1 Publication
    VAR_043484
    Natural varianti631 – 6311R → S in MRX94; homomers have minimal or no current; heteromers have altered desensitization kinetics. 1 Publication
    VAR_043485
    Natural varianti706 – 7061M → T in MRX94; homomers have minimal or no current; heteromers have altered desensitization kinetics. 1 Publication
    VAR_043486
    Natural varianti833 – 8331G → R in MRX94; reduced receptor expression possibly due to rapid degradation. 1 Publication
    VAR_043487

    Keywords - Diseasei

    Disease mutation, Mental retardation

    Organism-specific databases

    MIMi300699. phenotype.
    Orphaneti364028. X-linked intellectual disability due to GRIA3 anomalies.
    PharmGKBiPA28968.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2828Sequence AnalysisAdd
    BLAST
    Chaini29 – 894866Glutamate receptor 3PRO_0000011536Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi63 – 631N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi91 ↔ 340By similarity
    Glycosylationi266 – 2661N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi380 – 3801N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi415 – 4151N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi422 – 4221N-linked (GlcNAc...)Sequence Analysis
    Lipidationi621 – 6211S-palmitoyl cysteineBy similarity
    Disulfide bondi750 ↔ 805By similarity
    Lipidationi847 – 8471S-palmitoyl cysteineBy similarity
    Modified residuei877 – 8771PhosphotyrosineBy similarity
    Modified residuei887 – 8871PhosphotyrosineBy similarity

    Post-translational modificationi

    Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-621 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-847 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis By similarity.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

    Proteomic databases

    PaxDbiP42263.
    PRIDEiP42263.

    PTM databases

    PhosphoSiteiP42263.

    Expressioni

    Gene expression databases

    ArrayExpressiP42263.
    BgeeiP42263.
    CleanExiHS_GRIA3.
    GenevestigatoriP42263.

    Organism-specific databases

    HPAiCAB007799.

    Interactioni

    Subunit structurei

    Homotetramer or heterotetramer of pore-forming glutamate receptor subunits. Tetramers may be formed by the dimerization of dimers. Interacts with PRKCABP, GRIP1 and GRIP2 By similarity. Found in a complex with GRIA1, GRIA2, GRIA4, CNIH2, CNIH3, CACNG2, CACNG3, CACNG4, CACNG5, CACNG7 and CACNG8. Interacts with CACNG5 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi109149. 5 interactions.
    DIPiDIP-46195N.
    STRINGi9606.ENSP00000360302.

    Structurei

    3D structure databases

    ProteinModelPortaliP42263.
    SMRiP42263. Positions 32-849.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini29 – 552524ExtracellularBy similarityAdd
    BLAST
    Topological domaini574 – 60229CytoplasmicBy similarityAdd
    BLAST
    Topological domaini622 – 6276CytoplasmicBy similarity
    Topological domaini649 – 823175ExtracellularBy similarityAdd
    BLAST
    Topological domaini845 – 89450CytoplasmicBy similarityAdd
    BLAST

    Intramembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Intramembranei603 – 61816Helical; Pore-formingBy similarityAdd
    BLAST
    Intramembranei619 – 6213By similarity

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei553 – 57321HelicalBy similarityAdd
    BLAST
    Transmembranei628 – 64821HelicalBy similarityAdd
    BLAST
    Transmembranei824 – 84421Helical; Name=M4By similarityAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni508 – 5103Glutamate bindingBy similarity
    Regioni686 – 6872Glutamate bindingBy similarity

    Domaini

    The M4 transmembrane segment mediates tetramerization and is required for cell surface expression.By similarity

    Sequence similaritiesi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG316680.
    HOVERGENiHBG051839.
    InParanoidiP42263.
    KOiK05199.
    OMAiMVQQFLQ.
    OrthoDBiEOG7C2R0J.
    PhylomeDBiP42263.
    TreeFamiTF315232.

    Family and domain databases

    InterProiIPR001828. ANF_lig-bd_rcpt.
    IPR019594. Glu_rcpt_Glu/Gly-bd.
    IPR001320. Iontro_glu_rcpt.
    IPR001508. NMDA_rcpt.
    IPR028082. Peripla_BP_I.
    [Graphical view]
    PfamiPF01094. ANF_receptor. 1 hit.
    PF00060. Lig_chan. 1 hit.
    PF10613. Lig_chan-Glu_bd. 1 hit.
    [Graphical view]
    PRINTSiPR00177. NMDARECEPTOR.
    SMARTiSM00918. Lig_chan-Glu_bd. 1 hit.
    SM00079. PBPe. 1 hit.
    [Graphical view]
    SUPFAMiSSF53822. SSF53822. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform Flop (identifier: P42263-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MARQKKMGQS VLRAVFFLVL GLLGHSHGGF PNTISIGGLF MRNTVQEHSA    50
    FRFAVQLYNT NQNTTEKPFH LNYHVDHLDS SNSFSVTNAF CSQFSRGVYA 100
    IFGFYDQMSM NTLTSFCGAL HTSFVTPSFP TDADVQFVIQ MRPALKGAIL 150
    SLLGHYKWEK FVYLYDTERG FSILQAIMEA AVQNNWQVTA RSVGNIKDVQ 200
    EFRRIIEEMD RRQEKRYLID CEVERINTIL EQVVILGKHS RGYHYMLANL 250
    GFTDILLERV MHGGANITGF QIVNNENPMV QQFIQRWVRL DEREFPEAKN 300
    APLKYTSALT HDAILVIAEA FRYLRRQRVD VSRRGSAGDC LANPAVPWSQ 350
    GIDIERALKM VQVQGMTGNI QFDTYGRRTN YTIDVYEMKV SGSRKAGYWN 400
    EYERFVPFSD QQISNDSASS ENRTIVVTTI LESPYVMYKK NHEQLEGNER 450
    YEGYCVDLAY EIAKHVRIKY KLSIVGDGKY GARDPETKIW NGMVGELVYG 500
    RADIAVAPLT ITLVREEVID FSKPFMSLGI SIMIKKPQKS KPGVFSFLDP 550
    LAYEIWMCIV FAYIGVSVVL FLVSRFSPYE WHLEDNNEEP RDPQSPPDPP 600
    NEFGIFNSLW FSLGAFMQQG CDISPRSLSG RIVGGVWWFF TLIIISSYTA 650
    NLAAFLTVER MVSPIESAED LAKQTEIAYG TLDSGSTKEF FRRSKIAVYE 700
    KMWSYMKSAE PSVFTKTTAD GVARVRKSKG KFAFLLESTM NEYIEQRKPC 750
    DTMKVGGNLD SKGYGVATPK GSALRNAVNL AVLKLNEQGL LDKLKNKWWY 800
    DKGECGSGGG DSKDKTSALS LSNVAGVFYI LVGGLGLAMM VALIEFCYKS 850
    RAESKRMKLT KNTQNFKPAP ATNTQNYATY REGYNVYGTE SVKI 894
    Length:894
    Mass (Da):101,157
    Last modified:October 11, 2005 - v2
    Checksum:i178589A870E0D102
    GO
    Isoform Flip (identifier: P42263-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         776-811: NAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGD → TPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSG

    Show »
    Length:894
    Mass (Da):101,228
    Checksum:iEB3ED4EBBA353021
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti195 – 1951N → H in AAF61847. (PubMed:10644433)Curated
    Sequence conflicti775 – 7751R → G in AAA67922. (PubMed:7918660)Curated
    Sequence conflicti775 – 7751R → G in AAA67923. (PubMed:7918660)Curated
    Sequence conflicti775 – 7751R → G in CAA57567. 1 PublicationCurated
    Sequence conflicti775 – 7751R → G in AAF61847. (PubMed:10644433)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti450 – 4501R → Q in MRX94. 1 Publication
    VAR_043484
    Natural varianti525 – 5251F → L.3 Publications
    Corresponds to variant rs1052538 [ dbSNP | Ensembl ].
    VAR_023579
    Natural varianti631 – 6311R → S in MRX94; homomers have minimal or no current; heteromers have altered desensitization kinetics. 1 Publication
    VAR_043485
    Natural varianti706 – 7061M → T in MRX94; homomers have minimal or no current; heteromers have altered desensitization kinetics. 1 Publication
    VAR_043486
    Natural varianti833 – 8331G → R in MRX94; reduced receptor expression possibly due to rapid degradation. 1 Publication
    VAR_043487

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei776 – 81136NAVNL…SGGGD → TPVNLAVLKLSEQGILDKLK NKWWYDKGECGAKDSG in isoform Flip. 1 PublicationVSP_053351Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U10302 mRNA. Translation: AAA67923.1.
    U10301 mRNA. Translation: AAA67922.1.
    X82068 mRNA. Translation: CAA57567.1.
    AF159277
    , AF159262, AF159263, AF159264, AF159265, AF159266, AF159267, AF159268, AF159269, AF159270, AF159271, AF159272, AF159273, AF159274, AF159275 Genomic DNA. Translation: AAF61847.1.
    AF166365
    , AF166362, AF166363, AF166364 Genomic DNA. Translation: AAF97857.1.
    AF167332
    , AF166366, AF166367, AF166368, AF166369, AF166370, AF166371, AF166372, AF166373, AF166375 Genomic DNA. Translation: AAF97858.1.
    AF167332
    , AF166366, AF166367, AF166368, AF166369, AF166370, AF166371, AF166372, AF166373, AF166374 Genomic DNA. Translation: AAF97859.1.
    AL356213
    , AL035426, AL590139, Z83848, Z82899 Genomic DNA. Translation: CAI95643.1.
    AL356213
    , AL035426, AL590139, Z83848, Z82899 Genomic DNA. Translation: CAI95644.1.
    AL590139
    , AL035426, AL356213, Z83848, Z82899 Genomic DNA. Translation: CAI95164.1.
    AL590139
    , AL035426, AL356213, Z83848, Z82899 Genomic DNA. Translation: CAI95165.1.
    Z83848
    , AL590139, AL356213, AL035426, Z82899 Genomic DNA. Translation: CAI95709.1.
    Z83848
    , AL590139, AL356213, AL035426, Z82899 Genomic DNA. Translation: CAI95710.1.
    Z82899
    , Z83848, AL590139, AL356213, AL035426 Genomic DNA. Translation: CAI95664.1.
    Z82899
    , Z83848, AL590139, AL356213, AL035426 Genomic DNA. Translation: CAI95665.1.
    AL035426
    , Z83848, Z82899, AL590139, AL356213 Genomic DNA. Translation: CAI95683.1.
    AL035426
    , Z83848, Z82899, AL590139, AL356213 Genomic DNA. Translation: CAI95684.1.
    CH471107 Genomic DNA. Translation: EAX11865.1.
    CH471107 Genomic DNA. Translation: EAX11867.1.
    CCDSiCCDS14604.1. [P42263-1]
    CCDS14605.1. [P42263-2]
    PIRiS49460.
    S50128.
    S53696.
    RefSeqiNP_000819.3. NM_000828.4.
    NP_015564.4. NM_007325.4.
    UniGeneiHs.377070.

    Genome annotation databases

    EnsembliENST00000264357; ENSP00000264357; ENSG00000125675. [P42263-1]
    ENST00000371251; ENSP00000360297; ENSG00000125675. [P42263-1]
    ENST00000371256; ENSP00000360302; ENSG00000125675. [P42263-2]
    GeneIDi2892.
    KEGGihsa:2892.
    UCSCiuc004etq.4. human. [P42263-2]
    uc004etr.4. human. [P42263-1]

    Polymorphism databases

    DMDMi77416864.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U10302 mRNA. Translation: AAA67923.1 .
    U10301 mRNA. Translation: AAA67922.1 .
    X82068 mRNA. Translation: CAA57567.1 .
    AF159277
    , AF159262 , AF159263 , AF159264 , AF159265 , AF159266 , AF159267 , AF159268 , AF159269 , AF159270 , AF159271 , AF159272 , AF159273 , AF159274 , AF159275 Genomic DNA. Translation: AAF61847.1 .
    AF166365
    , AF166362 , AF166363 , AF166364 Genomic DNA. Translation: AAF97857.1 .
    AF167332
    , AF166366 , AF166367 , AF166368 , AF166369 , AF166370 , AF166371 , AF166372 , AF166373 , AF166375 Genomic DNA. Translation: AAF97858.1 .
    AF167332
    , AF166366 , AF166367 , AF166368 , AF166369 , AF166370 , AF166371 , AF166372 , AF166373 , AF166374 Genomic DNA. Translation: AAF97859.1 .
    AL356213
    , AL035426 , AL590139 , Z83848 , Z82899 Genomic DNA. Translation: CAI95643.1 .
    AL356213
    , AL035426 , AL590139 , Z83848 , Z82899 Genomic DNA. Translation: CAI95644.1 .
    AL590139
    , AL035426 , AL356213 , Z83848 , Z82899 Genomic DNA. Translation: CAI95164.1 .
    AL590139
    , AL035426 , AL356213 , Z83848 , Z82899 Genomic DNA. Translation: CAI95165.1 .
    Z83848
    , AL590139 , AL356213 , AL035426 , Z82899 Genomic DNA. Translation: CAI95709.1 .
    Z83848
    , AL590139 , AL356213 , AL035426 , Z82899 Genomic DNA. Translation: CAI95710.1 .
    Z82899
    , Z83848 , AL590139 , AL356213 , AL035426 Genomic DNA. Translation: CAI95664.1 .
    Z82899
    , Z83848 , AL590139 , AL356213 , AL035426 Genomic DNA. Translation: CAI95665.1 .
    AL035426
    , Z83848 , Z82899 , AL590139 , AL356213 Genomic DNA. Translation: CAI95683.1 .
    AL035426
    , Z83848 , Z82899 , AL590139 , AL356213 Genomic DNA. Translation: CAI95684.1 .
    CH471107 Genomic DNA. Translation: EAX11865.1 .
    CH471107 Genomic DNA. Translation: EAX11867.1 .
    CCDSi CCDS14604.1. [P42263-1 ]
    CCDS14605.1. [P42263-2 ]
    PIRi S49460.
    S50128.
    S53696.
    RefSeqi NP_000819.3. NM_000828.4.
    NP_015564.4. NM_007325.4.
    UniGenei Hs.377070.

    3D structure databases

    ProteinModelPortali P42263.
    SMRi P42263. Positions 32-849.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 109149. 5 interactions.
    DIPi DIP-46195N.
    STRINGi 9606.ENSP00000360302.

    Chemistry

    BindingDBi P42263.
    ChEMBLi CHEMBL2096670.
    DrugBanki DB00142. L-Glutamic Acid.
    GuidetoPHARMACOLOGYi 446.

    Protein family/group databases

    TCDBi 1.A.10.1.4. the glutamate-gated ion channel (gic) family of neurotransmitter receptors.

    PTM databases

    PhosphoSitei P42263.

    Polymorphism databases

    DMDMi 77416864.

    Proteomic databases

    PaxDbi P42263.
    PRIDEi P42263.

    Protocols and materials databases

    DNASUi 2892.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000264357 ; ENSP00000264357 ; ENSG00000125675 . [P42263-1 ]
    ENST00000371251 ; ENSP00000360297 ; ENSG00000125675 . [P42263-1 ]
    ENST00000371256 ; ENSP00000360302 ; ENSG00000125675 . [P42263-2 ]
    GeneIDi 2892.
    KEGGi hsa:2892.
    UCSCi uc004etq.4. human. [P42263-2 ]
    uc004etr.4. human. [P42263-1 ]

    Organism-specific databases

    CTDi 2892.
    GeneCardsi GC0XP122318.
    HGNCi HGNC:4573. GRIA3.
    HPAi CAB007799.
    MIMi 300699. phenotype.
    305915. gene.
    neXtProti NX_P42263.
    Orphaneti 364028. X-linked intellectual disability due to GRIA3 anomalies.
    PharmGKBi PA28968.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG316680.
    HOVERGENi HBG051839.
    InParanoidi P42263.
    KOi K05199.
    OMAi MVQQFLQ.
    OrthoDBi EOG7C2R0J.
    PhylomeDBi P42263.
    TreeFami TF315232.

    Enzyme and pathway databases

    Reactomei REACT_18307. Trafficking of AMPA receptors.
    REACT_18338. Activation of AMPA receptors.
    REACT_18422. Trafficking of GluR2-containing AMPA receptors.
    REACT_20594. Unblocking of NMDA receptor, glutamate binding and activation.
    SignaLinki P42263.

    Miscellaneous databases

    ChiTaRSi GRIA3. human.
    GeneWikii GRIA3.
    GenomeRNAii 2892.
    NextBioi 11437.
    PROi P42263.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P42263.
    Bgeei P42263.
    CleanExi HS_GRIA3.
    Genevestigatori P42263.

    Family and domain databases

    InterProi IPR001828. ANF_lig-bd_rcpt.
    IPR019594. Glu_rcpt_Glu/Gly-bd.
    IPR001320. Iontro_glu_rcpt.
    IPR001508. NMDA_rcpt.
    IPR028082. Peripla_BP_I.
    [Graphical view ]
    Pfami PF01094. ANF_receptor. 1 hit.
    PF00060. Lig_chan. 1 hit.
    PF10613. Lig_chan-Glu_bd. 1 hit.
    [Graphical view ]
    PRINTSi PR00177. NMDARECEPTOR.
    SMARTi SM00918. Lig_chan-Glu_bd. 1 hit.
    SM00079. PBPe. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53822. SSF53822. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Human glutamate receptor hGluR3 flip and flop isoforms: cloning and sequencing of the cDNAs and primary structure of the proteins."
      Rampersad V., Elliott C.E., Nutt S.L., Foldes R.L., Kamboj R.K.
      Biochim. Biophys. Acta 1219:563-566(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS FLIP AND FLOP), VARIANT LEU-525.
      Tissue: Hippocampus.
    2. McLaughlin D.P., Kerwin R.W.
      Submitted (OCT-1994) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
      Tissue: Brain.
    3. "Characterization of the human glutamate receptor subunit 3 gene (GRIA3), a candidate for bipolar disorder and nonspecific X-linked mental retardation."
      Gecz J., Barnett S., Liu J., Hollway G., Donnelly A., Eyre H., Eshkevari H.S., Baltazar R., Grunn A., Nagaraja R., Gilliam C., Peltonen L., Sutherland G.R., Baron M., Mulley J.C.
      Genomics 62:356-368(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT LEU-525.
    4. "Candidate gene analysis in Rett syndrome and the identification of 21 SNPs in Xq."
      Amir R., Dahle E.J., Toriolo D., Zoghbi H.Y.
      Am. J. Med. Genet. 90:69-71(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT LEU-525.
    5. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins."
      Kato A.S., Gill M.B., Ho M.T., Yu H., Tu Y., Siuda E.R., Wang H., Qian Y.W., Nisenbaum E.S., Tomita S., Bredt D.S.
      Neuron 68:1082-1096(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    8. Cited for: VARIANTS MRX94 GLN-450; SER-631; THR-706 AND ARG-833, CHARACTERIZATION OF VARIANTS MRX94 SER-631; THR-706 AND ARG-833.

    Entry informationi

    Entry nameiGRIA3_HUMAN
    AccessioniPrimary (citable) accession number: P42263
    Secondary accession number(s): D3DTF1
    , Q4VXD5, Q4VXD6, Q9HDA0, Q9HDA1, Q9HDA2, Q9P0H1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1995
    Last sequence update: October 11, 2005
    Last modified: October 1, 2014
    This is version 151 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds AMPA (quisqualate) > glutamate > kainate.

    Caution

    It is uncertain whether Met-1 or Met-7 is the initiator.Curated

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3