Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glutamate receptor 1

Gene

GRIA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei464GlutamateBy similarity1
Binding sitei499GlutamateBy similarity1
Binding sitei719GlutamateBy similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Ligand-gated ion channel, Receptor

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

BioCyciZFISH:ENSG00000155511-MONOMER.
ReactomeiR-HSA-204005. COPII (Coat Protein 2) Mediated Vesicle Transport.
R-HSA-399710. Activation of AMPA receptors.
R-HSA-399719. Trafficking of AMPA receptors.
R-HSA-416993. Trafficking of GluR2-containing AMPA receptors.
R-HSA-438066. Unblocking of NMDA receptor, glutamate binding and activation.
R-HSA-5694530. Cargo concentration in the ER.
R-HSA-8849932. SALM protein interactions at the synapses.
SignaLinkiP42261.
SIGNORiP42261.

Names & Taxonomyi

Protein namesi
Recommended name:
Glutamate receptor 1
Short name:
GluR-1
Alternative name(s):
AMPA-selective glutamate receptor 1
GluR-A
GluR-K1
Glutamate receptor ionotropic, AMPA 1
Short name:
GluA1
Gene namesi
Name:GRIA1
Synonyms:GLUH1, GLUR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:4571. GRIA1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini19 – 536ExtracellularBy similarityAdd BLAST518
Transmembranei537 – 557HelicalBy similarityAdd BLAST21
Topological domaini558 – 584CytoplasmicBy similarityAdd BLAST27
Intramembranei585 – 600Helical; Pore-formingBy similarityAdd BLAST16
Intramembranei601 – 603By similarity3
Topological domaini604 – 609CytoplasmicBy similarity6
Transmembranei610 – 630HelicalBy similarityAdd BLAST21
Topological domaini631 – 805ExtracellularBy similarityAdd BLAST175
Transmembranei806 – 826Helical; Name=M4Add BLAST21
Topological domaini827 – 906CytoplasmicBy similarityAdd BLAST80

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi2890.
OpenTargetsiENSG00000155511.
PharmGKBiPA28966.

Chemistry databases

ChEMBLiCHEMBL2009.
DrugBankiDB01189. Desflurane.
DB00228. Enflurane.
DB00898. Ethanol.
DB00753. Isoflurane.
DB01028. Methoxyflurane.
DB08883. Perampanel.
DB01236. Sevoflurane.
GuidetoPHARMACOLOGYi444.

Polymorphism and mutation databases

BioMutaiGRIA1.
DMDMi116242505.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 18Sequence analysisAdd BLAST18
ChainiPRO_000001152919 – 906Glutamate receptor 1Add BLAST888

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi63N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi75 ↔ 323By similarity
Glycosylationi249N-linked (GlcNAc...)Sequence analysis1
Glycosylationi257N-linked (GlcNAc...)Sequence analysis1
Glycosylationi363N-linked (GlcNAc...)Sequence analysis1
Glycosylationi401N-linked (GlcNAc...)Sequence analysis1
Glycosylationi406N-linked (GlcNAc...)Sequence analysis1
Lipidationi603S-palmitoyl cysteineBy similarity1
Modified residuei645PhosphoserineBy similarity1
Modified residuei710PhosphoserineBy similarity1
Disulfide bondi732 ↔ 787By similarity
Lipidationi829S-palmitoyl cysteineBy similarity1
Modified residuei849PhosphoserineBy similarity1
Modified residuei863PhosphoserineBy similarity1

Post-translational modificationi

Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-603 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-829 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiP42261.
PeptideAtlasiP42261.
PRIDEiP42261.

PTM databases

iPTMnetiP42261.
PhosphoSitePlusiP42261.
SwissPalmiP42261.

Expressioni

Tissue specificityi

Widely expressed in brain.

Gene expression databases

BgeeiENSG00000155511.
CleanExiHS_GRIA1.
GenevisibleiP42261. HS.

Organism-specific databases

HPAiCAB001965.
HPA035202.

Interactioni

Subunit structurei

Homotetramer or heterotetramer of pore-forming glutamate receptor subunits. Tetramers may be formed by the dimerization of dimers. Interacts with DLG1 via its C-terminus. Found in a complex with GRIA2, GRIA3, GRIA4, CNIH2, CNIH3, CACNG2, CACNG3, CACNG4, CACNG5, CACNG7 and CACNG8. Interacts with HIP1, RASGRF2, SYNDIG1 and LRFN1. Interacts with SNX27 (via PDZ domain); the interaction is required for recycling to the plasma membrane when endocytosed and prevent degradation in lysosomes. Interacts (via PDZ-binding motif) with SHANK3 (via PDZ domain).2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi109147. 18 interactors.
DIPiDIP-41487N.
MINTiMINT-271172.
STRINGi9606.ENSP00000285900.

Chemistry databases

BindingDBiP42261.

Structurei

3D structure databases

ProteinModelPortaliP42261.
SMRiP42261.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni492 – 494Glutamate bindingBy similarity3
Regioni668 – 669Glutamate bindingBy similarity2

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi903 – 906PDZ-binding4

Domaini

The M4 transmembrane segment mediates tetramerization and is required for cell surface expression.

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1054. Eukaryota.
ENOG410XPSH. LUCA.
GeneTreeiENSGT00760000118920.
HOGENOMiHOG000234372.
HOVERGENiHBG051839.
InParanoidiP42261.
KOiK05197.
OMAiMQRSFTI.
OrthoDBiEOG091G11CB.
PhylomeDBiP42261.
TreeFamiTF315232.

Family and domain databases

InterProiIPR001828. ANF_lig-bd_rcpt.
IPR019594. Glu/Gly-bd.
IPR001508. Iono_rcpt_met.
IPR001320. Iontro_rcpt.
IPR028082. Peripla_BP_I.
[Graphical view]
PfamiPF01094. ANF_receptor. 1 hit.
PF00060. Lig_chan. 1 hit.
PF10613. Lig_chan-Glu_bd. 1 hit.
[Graphical view]
PRINTSiPR00177. NMDARECEPTOR.
SMARTiSM00918. Lig_chan-Glu_bd. 1 hit.
SM00079. PBPe. 1 hit.
[Graphical view]
SUPFAMiSSF53822. SSF53822. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Flop (identifier: P42261-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQHIFAFFCT GFLGAVVGAN FPNNIQIGGL FPNQQSQEHA AFRFALSQLT
60 70 80 90 100
EPPKLLPQID IVNISDSFEM TYRFCSQFSK GVYAIFGFYE RRTVNMLTSF
110 120 130 140 150
CGALHVCFIT PSFPVDTSNQ FVLQLRPELQ DALISIIDHY KWQKFVYIYD
160 170 180 190 200
ADRGLSVLQK VLDTAAEKNW QVTAVNILTT TEEGYRMLFQ DLEKKKERLV
210 220 230 240 250
VVDCESERLN AILGQIIKLE KNGIGYHYIL ANLGFMDIDL NKFKESGANV
260 270 280 290 300
TGFQLVNYTD TIPAKIMQQW KNSDARDHTR VDWKRPKYTS ALTYDGVKVM
310 320 330 340 350
AEAFQSLRRQ RIDISRRGNA GDCLANPAVP WGQGIDIQRA LQQVRFEGLT
360 370 380 390 400
GNVQFNEKGR RTNYTLHVIE MKHDGIRKIG YWNEDDKFVP AATDAQAGGD
410 420 430 440 450
NSSVQNRTYI VTTILEDPYV MLKKNANQFE GNDRYEGYCV ELAAEIAKHV
460 470 480 490 500
GYSYRLEIVS DGKYGARDPD TKAWNGMVGE LVYGRADVAV APLTITLVRE
510 520 530 540 550
EVIDFSKPFM SLGISIMIKK PQKSKPGVFS FLDPLAYEIW MCIVFAYIGV
560 570 580 590 600
SVVLFLVSRF SPYEWHSEEF EEGRDQTTSD QSNEFGIFNS LWFSLGAFMQ
610 620 630 640 650
QGCDISPRSL SGRIVGGVWW FFTLIIISSY TANLAAFLTV ERMVSPIESA
660 670 680 690 700
EDLAKQTEIA YGTLEAGSTK EFFRRSKIAV FEKMWTYMKS AEPSVFVRTT
710 720 730 740 750
EEGMIRVRKS KGKYAYLLES TMNEYIEQRK PCDTMKVGGN LDSKGYGIAT
760 770 780 790 800
PKGSALRNPV NLAVLKLNEQ GLLDKLKNKW WYDKGECGSG GGDSKDKTSA
810 820 830 840 850
LSLSNVAGVF YILIGGLGLA MLVALIEFCY KSRSESKRMK GFCLIPQQSI
860 870 880 890 900
NEAIRTSTLP RNSGAGASSG GSGENGRVVS HDFPKSMQSI PCMSHSSGMP

LGATGL
Length:906
Mass (Da):101,506
Last modified:October 17, 2006 - v2
Checksum:i03EA1E026D0A9A2F
GO
Isoform Flip (identifier: P42261-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     758-793: NPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGD → GPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSG

Show »
Length:906
Mass (Da):101,482
Checksum:i4C1973DBFE98C979
GO
Isoform 3 (identifier: P42261-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-154: FCSQFSKGVY...FVYIYDADRG → C

Show »
Length:826
Mass (Da):92,172
Checksum:i53F69105FB85CFC9
GO
Isoform 4 (identifier: P42261-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.

Show »
Length:837
Mass (Da):93,900
Checksum:i54246EAC4BFFB9F0
GO
Isoform 5 (identifier: P42261-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MQHIFAFFCTGFLGAVVGANFPNNIQIG → MCCSTHLFQPLQLAGGLEWPWSNLLCFLTPVKLHPEVW

Note: No experimental confirmation available.
Show »
Length:916
Mass (Da):102,888
Checksum:iC49F9C13D74EC7E3
GO
Isoform 6 (identifier: P42261-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MQHIFAFFCTGFLGAVVGANFPNNIQIG → MCCSTHLFQPLQLAGGLEWPWSNLLCFLTPVKLHPEVW
     758-793: NPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGD → GPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSG

Note: No experimental confirmation available.
Show »
Length:916
Mass (Da):102,864
Checksum:i8B6CF1CA44DC94B5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti345R → A in CAA41491 (PubMed:1320959).Curated1
Sequence conflicti375G → S in AAA58395 (PubMed:1311100).Curated1
Sequence conflicti738G → E in BAH12004 (PubMed:14702039).Curated1
Sequence conflicti863S → SA in AAA58613 (PubMed:1652753).Curated1
Sequence conflicti865 – 867AGA → TAP in AAA58613 (PubMed:1652753).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_028071487D → N.Corresponds to variant rs13166146dbSNPEnsembl.1
Natural variantiVAR_028072521P → T.Corresponds to variant rs13166161dbSNPEnsembl.1
Natural variantiVAR_028073536A → S.Corresponds to variant rs13166438dbSNPEnsembl.1
Natural variantiVAR_028074548I → M.Corresponds to variant rs13186241dbSNPEnsembl.1
Natural variantiVAR_028075588F → L.Corresponds to variant rs13186534dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0451191 – 69Missing in isoform 4. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_0470241 – 28MQHIF…NIQIG → MCCSTHLFQPLQLAGGLEWP WSNLLCFLTPVKLHPEVW in isoform 5 and isoform 6. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_04512074 – 154FCSQF…DADRG → C in isoform 3. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_053349758 – 793NPVNL…SGGGD → GPVNLAVLKLSEQGVLDKLK SKWWYDKGECGSKDSG in isoform Flip and isoform 6. 2 PublicationsAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64752 mRNA. Translation: AAA58613.1.
X58633 mRNA. Translation: CAA41491.1.
M81886 mRNA. Translation: AAA58395.1.
AK295039 mRNA. Translation: BAH11956.1.
AK295184 mRNA. Translation: BAH12004.1.
AK295827 mRNA. Translation: BAH12192.1.
AK315934 mRNA. Translation: BAH14305.1.
AC010613 Genomic DNA. No translation available.
AC025156 Genomic DNA. No translation available.
AC091960 Genomic DNA. No translation available.
AC091962 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61649.1.
CH471062 Genomic DNA. Translation: EAW61650.1.
BC111734 mRNA. Translation: AAI11735.1.
CCDSiCCDS4322.1. [P42261-1]
CCDS47318.1. [P42261-2]
CCDS58986.1. [P42261-3]
CCDS58987.1. [P42261-5]
CCDS58988.1. [P42261-6]
CCDS58989.1. [P42261-4]
PIRiA40222.
A41273.
S25852.
S38723.
RefSeqiNP_000818.2. NM_000827.3. [P42261-1]
NP_001107655.1. NM_001114183.1. [P42261-2]
NP_001244948.1. NM_001258019.1. [P42261-3]
NP_001244950.1. NM_001258021.1. [P42261-5]
NP_001244951.1. NM_001258022.1. [P42261-6]
NP_001244952.1. NM_001258023.1. [P42261-4]
UniGeneiHs.519693.
Hs.737709.

Genome annotation databases

EnsembliENST00000285900; ENSP00000285900; ENSG00000155511. [P42261-1]
ENST00000340592; ENSP00000339343; ENSG00000155511. [P42261-2]
ENST00000448073; ENSP00000415569; ENSG00000155511. [P42261-6]
ENST00000518142; ENSP00000427920; ENSG00000155511. [P42261-3]
ENST00000518783; ENSP00000428994; ENSG00000155511. [P42261-5]
ENST00000521843; ENSP00000427864; ENSG00000155511. [P42261-4]
GeneIDi2890.
KEGGihsa:2890.
UCSCiuc003luy.5. human. [P42261-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64752 mRNA. Translation: AAA58613.1.
X58633 mRNA. Translation: CAA41491.1.
M81886 mRNA. Translation: AAA58395.1.
AK295039 mRNA. Translation: BAH11956.1.
AK295184 mRNA. Translation: BAH12004.1.
AK295827 mRNA. Translation: BAH12192.1.
AK315934 mRNA. Translation: BAH14305.1.
AC010613 Genomic DNA. No translation available.
AC025156 Genomic DNA. No translation available.
AC091960 Genomic DNA. No translation available.
AC091962 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61649.1.
CH471062 Genomic DNA. Translation: EAW61650.1.
BC111734 mRNA. Translation: AAI11735.1.
CCDSiCCDS4322.1. [P42261-1]
CCDS47318.1. [P42261-2]
CCDS58986.1. [P42261-3]
CCDS58987.1. [P42261-5]
CCDS58988.1. [P42261-6]
CCDS58989.1. [P42261-4]
PIRiA40222.
A41273.
S25852.
S38723.
RefSeqiNP_000818.2. NM_000827.3. [P42261-1]
NP_001107655.1. NM_001114183.1. [P42261-2]
NP_001244948.1. NM_001258019.1. [P42261-3]
NP_001244950.1. NM_001258021.1. [P42261-5]
NP_001244951.1. NM_001258022.1. [P42261-6]
NP_001244952.1. NM_001258023.1. [P42261-4]
UniGeneiHs.519693.
Hs.737709.

3D structure databases

ProteinModelPortaliP42261.
SMRiP42261.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109147. 18 interactors.
DIPiDIP-41487N.
MINTiMINT-271172.
STRINGi9606.ENSP00000285900.

Chemistry databases

BindingDBiP42261.
ChEMBLiCHEMBL2009.
DrugBankiDB01189. Desflurane.
DB00228. Enflurane.
DB00898. Ethanol.
DB00753. Isoflurane.
DB01028. Methoxyflurane.
DB08883. Perampanel.
DB01236. Sevoflurane.
GuidetoPHARMACOLOGYi444.

PTM databases

iPTMnetiP42261.
PhosphoSitePlusiP42261.
SwissPalmiP42261.

Polymorphism and mutation databases

BioMutaiGRIA1.
DMDMi116242505.

Proteomic databases

PaxDbiP42261.
PeptideAtlasiP42261.
PRIDEiP42261.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000285900; ENSP00000285900; ENSG00000155511. [P42261-1]
ENST00000340592; ENSP00000339343; ENSG00000155511. [P42261-2]
ENST00000448073; ENSP00000415569; ENSG00000155511. [P42261-6]
ENST00000518142; ENSP00000427920; ENSG00000155511. [P42261-3]
ENST00000518783; ENSP00000428994; ENSG00000155511. [P42261-5]
ENST00000521843; ENSP00000427864; ENSG00000155511. [P42261-4]
GeneIDi2890.
KEGGihsa:2890.
UCSCiuc003luy.5. human. [P42261-1]

Organism-specific databases

CTDi2890.
DisGeNETi2890.
GeneCardsiGRIA1.
H-InvDBHIX0032120.
HGNCiHGNC:4571. GRIA1.
HPAiCAB001965.
HPA035202.
MIMi138248. gene.
neXtProtiNX_P42261.
OpenTargetsiENSG00000155511.
PharmGKBiPA28966.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1054. Eukaryota.
ENOG410XPSH. LUCA.
GeneTreeiENSGT00760000118920.
HOGENOMiHOG000234372.
HOVERGENiHBG051839.
InParanoidiP42261.
KOiK05197.
OMAiMQRSFTI.
OrthoDBiEOG091G11CB.
PhylomeDBiP42261.
TreeFamiTF315232.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000155511-MONOMER.
ReactomeiR-HSA-204005. COPII (Coat Protein 2) Mediated Vesicle Transport.
R-HSA-399710. Activation of AMPA receptors.
R-HSA-399719. Trafficking of AMPA receptors.
R-HSA-416993. Trafficking of GluR2-containing AMPA receptors.
R-HSA-438066. Unblocking of NMDA receptor, glutamate binding and activation.
R-HSA-5694530. Cargo concentration in the ER.
R-HSA-8849932. SALM protein interactions at the synapses.
SignaLinkiP42261.
SIGNORiP42261.

Miscellaneous databases

ChiTaRSiGRIA1. human.
GeneWikiiGRIA1.
GenomeRNAii2890.
PROiP42261.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000155511.
CleanExiHS_GRIA1.
GenevisibleiP42261. HS.

Family and domain databases

InterProiIPR001828. ANF_lig-bd_rcpt.
IPR019594. Glu/Gly-bd.
IPR001508. Iono_rcpt_met.
IPR001320. Iontro_rcpt.
IPR028082. Peripla_BP_I.
[Graphical view]
PfamiPF01094. ANF_receptor. 1 hit.
PF00060. Lig_chan. 1 hit.
PF10613. Lig_chan-Glu_bd. 1 hit.
[Graphical view]
PRINTSiPR00177. NMDARECEPTOR.
SMARTiSM00918. Lig_chan-Glu_bd. 1 hit.
SM00079. PBPe. 1 hit.
[Graphical view]
SUPFAMiSSF53822. SSF53822. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiGRIA1_HUMAN
AccessioniPrimary (citable) accession number: P42261
Secondary accession number(s): B7Z2S0
, B7Z2W8, B7Z3F6, B7Z9G9, D3DQI4, E7ESV8, Q2NKM6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: October 17, 2006
Last modified: November 2, 2016
This is version 179 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds AMPA (quisqualate) > glutamate > kainate.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.