SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P42261

- GRIA1_HUMAN

UniProt

P42261 - GRIA1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Glutamate receptor 1
Gene
GRIA1, GLUH1, GLUR1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.2 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei464 – 4641Glutamate By similarity
Binding sitei499 – 4991Glutamate By similarity
Binding sitei719 – 7191Glutamate By similarity

GO - Molecular functioni

  1. PDZ domain binding Source: BHF-UCL
  2. alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity Source: UniProtKB
  3. extracellular-glutamate-gated ion channel activity Source: RefGenome
  4. glutamate receptor activity Source: ProtInc
  5. protein binding Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. ion transmembrane transport Source: GOC
  2. ionotropic glutamate receptor signaling pathway Source: GOC
  3. long-term memory Source: Ensembl
  4. receptor internalization Source: Ensembl
  5. signal transduction Source: ProtInc
  6. synaptic transmission Source: Reactome
  7. synaptic transmission, glutamatergic Source: RefGenome
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Ligand-gated ion channel, Receptor

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

ReactomeiREACT_18307. Trafficking of AMPA receptors.
REACT_18338. Activation of AMPA receptors.
REACT_18422. Trafficking of GluR2-containing AMPA receptors.
REACT_20594. Unblocking of NMDA receptor, glutamate binding and activation.
SignaLinkiP42261.

Names & Taxonomyi

Protein namesi
Recommended name:
Glutamate receptor 1
Short name:
GluR-1
Alternative name(s):
AMPA-selective glutamate receptor 1
GluR-A
GluR-K1
Glutamate receptor ionotropic, AMPA 1
Short name:
GluA1
Gene namesi
Name:GRIA1
Synonyms:GLUH1, GLUR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:4571. GRIA1.

Subcellular locationi

Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. Cell junctionsynapsepostsynaptic cell membrane; Multi-pass membrane protein. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell projectiondendrite By similarity. Cell projectiondendritic spine By similarity
Note: Interaction with CACNG2, CNIH2 and CNIH3 promotes cell surface expression By similarity.1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini19 – 536518Extracellular By similarity
Add
BLAST
Transmembranei537 – 55721Helical; By similarity
Add
BLAST
Topological domaini558 – 58427Cytoplasmic By similarity
Add
BLAST
Intramembranei585 – 60016Helical; Pore-forming; By similarity
Add
BLAST
Intramembranei601 – 6033 By similarity
Topological domaini604 – 6096Cytoplasmic By similarity
Transmembranei610 – 63021Helical; By similarity
Add
BLAST
Topological domaini631 – 805175Extracellular By similarity
Add
BLAST
Transmembranei806 – 82621Helical; Name=M4
Add
BLAST
Topological domaini827 – 90680Cytoplasmic By similarity
Add
BLAST

GO - Cellular componenti

  1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: UniProtKB
  2. cell junction Source: UniProtKB-KW
  3. cell surface Source: BHF-UCL
  4. dendrite Source: UniProtKB
  5. dendrite membrane Source: Ensembl
  6. dendritic spine Source: UniProtKB
  7. endocytic vesicle membrane Source: Reactome
  8. endoplasmic reticulum membrane Source: UniProtKB-SubCell
  9. neuron spine Source: BHF-UCL
  10. neuronal cell body Source: BHF-UCL
  11. plasma membrane Source: Reactome
  12. postsynaptic density Source: UniProtKB
  13. postsynaptic membrane Source: RefGenome
  14. synaptic vesicle Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA28966.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1818 Reviewed prediction
Add
BLAST
Chaini19 – 906888Glutamate receptor 1
PRO_0000011529Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi63 – 631N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi75 ↔ 323 By similarity
Glycosylationi249 – 2491N-linked (GlcNAc...) Reviewed prediction
Glycosylationi257 – 2571N-linked (GlcNAc...) Reviewed prediction
Glycosylationi363 – 3631N-linked (GlcNAc...) Reviewed prediction
Glycosylationi401 – 4011N-linked (GlcNAc...) Reviewed prediction
Glycosylationi406 – 4061N-linked (GlcNAc...) Reviewed prediction
Lipidationi603 – 6031S-palmitoyl cysteine By similarity
Modified residuei645 – 6451Phosphoserine By similarity
Modified residuei710 – 7101Phosphoserine By similarity
Disulfide bondi732 ↔ 787 By similarity
Lipidationi829 – 8291S-palmitoyl cysteine By similarity
Modified residuei849 – 8491Phosphoserine By similarity
Modified residuei863 – 8631Phosphoserine By similarity

Post-translational modificationi

Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-603 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-829 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiP42261.
PRIDEiP42261.

PTM databases

PhosphoSiteiP42261.

Expressioni

Tissue specificityi

Widely expressed in brain.

Gene expression databases

ArrayExpressiP42261.
BgeeiP42261.
CleanExiHS_GRIA1.
GenevestigatoriP42261.

Organism-specific databases

HPAiCAB001965.
HPA035202.

Interactioni

Subunit structurei

Homotetramer or heterotetramer of pore-forming glutamate receptor subunits. Tetramers may be formed by the dimerization of dimers. Interacts with DLG1 via its C-terminus. Found in a complex with GRIA2, GRIA3, GRIA4, CNIH2, CNIH3, CACNG2, CACNG3, CACNG4, CACNG5, CACNG7 and CACNG8. Interacts with HIP1, RASGRF2, SYNDIG1 and LRFN1. Interacts with SNX27 (via PDZ domain); the interaction is required for recycling to the plasma membrane when endocytosed and prevent degradation in lysosomes. Interacts (via PDZ-binding motif) with SHANK3 (via PDZ domain).2 Publications

Protein-protein interaction databases

BioGridi109147. 18 interactions.
DIPiDIP-41487N.
MINTiMINT-271172.
STRINGi9606.ENSP00000285900.

Structurei

3D structure databases

ProteinModelPortaliP42261.
SMRiP42261. Positions 22-831.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni492 – 4943Glutamate binding By similarity
Regioni668 – 6692Glutamate binding By similarity

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi903 – 9064PDZ-binding

Domaini

The M4 transmembrane segment mediates tetramerization and is required for cell surface expression.

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG316680.
HOGENOMiHOG000234372.
HOVERGENiHBG051839.
KOiK05197.
OMAiFAFFCTS.
OrthoDBiEOG7C2R0J.
PhylomeDBiP42261.
TreeFamiTF315232.

Family and domain databases

InterProiIPR001828. ANF_lig-bd_rcpt.
IPR019594. Glu_rcpt_Glu/Gly-bd.
IPR001320. Iontro_glu_rcpt.
IPR001508. NMDA_rcpt.
IPR028082. Peripla_BP_I.
[Graphical view]
PfamiPF01094. ANF_receptor. 1 hit.
PF00060. Lig_chan. 1 hit.
PF10613. Lig_chan-Glu_bd. 1 hit.
[Graphical view]
PRINTSiPR00177. NMDARECEPTOR.
SMARTiSM00918. Lig_chan-Glu_bd. 1 hit.
SM00079. PBPe. 1 hit.
[Graphical view]
SUPFAMiSSF53822. SSF53822. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform Flop (identifier: P42261-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQHIFAFFCT GFLGAVVGAN FPNNIQIGGL FPNQQSQEHA AFRFALSQLT    50
EPPKLLPQID IVNISDSFEM TYRFCSQFSK GVYAIFGFYE RRTVNMLTSF 100
CGALHVCFIT PSFPVDTSNQ FVLQLRPELQ DALISIIDHY KWQKFVYIYD 150
ADRGLSVLQK VLDTAAEKNW QVTAVNILTT TEEGYRMLFQ DLEKKKERLV 200
VVDCESERLN AILGQIIKLE KNGIGYHYIL ANLGFMDIDL NKFKESGANV 250
TGFQLVNYTD TIPAKIMQQW KNSDARDHTR VDWKRPKYTS ALTYDGVKVM 300
AEAFQSLRRQ RIDISRRGNA GDCLANPAVP WGQGIDIQRA LQQVRFEGLT 350
GNVQFNEKGR RTNYTLHVIE MKHDGIRKIG YWNEDDKFVP AATDAQAGGD 400
NSSVQNRTYI VTTILEDPYV MLKKNANQFE GNDRYEGYCV ELAAEIAKHV 450
GYSYRLEIVS DGKYGARDPD TKAWNGMVGE LVYGRADVAV APLTITLVRE 500
EVIDFSKPFM SLGISIMIKK PQKSKPGVFS FLDPLAYEIW MCIVFAYIGV 550
SVVLFLVSRF SPYEWHSEEF EEGRDQTTSD QSNEFGIFNS LWFSLGAFMQ 600
QGCDISPRSL SGRIVGGVWW FFTLIIISSY TANLAAFLTV ERMVSPIESA 650
EDLAKQTEIA YGTLEAGSTK EFFRRSKIAV FEKMWTYMKS AEPSVFVRTT 700
EEGMIRVRKS KGKYAYLLES TMNEYIEQRK PCDTMKVGGN LDSKGYGIAT 750
PKGSALRNPV NLAVLKLNEQ GLLDKLKNKW WYDKGECGSG GGDSKDKTSA 800
LSLSNVAGVF YILIGGLGLA MLVALIEFCY KSRSESKRMK GFCLIPQQSI 850
NEAIRTSTLP RNSGAGASSG GSGENGRVVS HDFPKSMQSI PCMSHSSGMP 900
LGATGL 906
Length:906
Mass (Da):101,506
Last modified:October 17, 2006 - v2
Checksum:i03EA1E026D0A9A2F
GO
Isoform Flip (identifier: P42261-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     758-793: NPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGD → GPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSG

Show »
Length:906
Mass (Da):101,482
Checksum:i4C1973DBFE98C979
GO
Isoform 3 (identifier: P42261-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-154: FCSQFSKGVY...FVYIYDADRG → C

Show »
Length:826
Mass (Da):92,172
Checksum:i53F69105FB85CFC9
GO
Isoform 4 (identifier: P42261-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.

Show »
Length:837
Mass (Da):93,900
Checksum:i54246EAC4BFFB9F0
GO
Isoform 5 (identifier: P42261-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MQHIFAFFCTGFLGAVVGANFPNNIQIG → MCCSTHLFQPLQLAGGLEWPWSNLLCFLTPVKLHPEVW

Note: No experimental confirmation available.

Show »
Length:916
Mass (Da):102,888
Checksum:iC49F9C13D74EC7E3
GO
Isoform 6 (identifier: P42261-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MQHIFAFFCTGFLGAVVGANFPNNIQIG → MCCSTHLFQPLQLAGGLEWPWSNLLCFLTPVKLHPEVW
     758-793: NPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGD → GPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSG

Note: No experimental confirmation available.

Show »
Length:916
Mass (Da):102,864
Checksum:i8B6CF1CA44DC94B5
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti487 – 4871D → N.
Corresponds to variant rs13166146 [ dbSNP | Ensembl ].
VAR_028071
Natural varianti521 – 5211P → T.
Corresponds to variant rs13166161 [ dbSNP | Ensembl ].
VAR_028072
Natural varianti536 – 5361A → S.
Corresponds to variant rs13166438 [ dbSNP | Ensembl ].
VAR_028073
Natural varianti548 – 5481I → M.
Corresponds to variant rs13186241 [ dbSNP | Ensembl ].
VAR_028074
Natural varianti588 – 5881F → L.
Corresponds to variant rs13186534 [ dbSNP | Ensembl ].
VAR_028075

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6969Missing in isoform 4.
VSP_045119Add
BLAST
Alternative sequencei1 – 2828MQHIF…NIQIG → MCCSTHLFQPLQLAGGLEWP WSNLLCFLTPVKLHPEVW in isoform 5 and isoform 6.
VSP_047024Add
BLAST
Alternative sequencei74 – 15481FCSQF…DADRG → C in isoform 3.
VSP_045120Add
BLAST
Alternative sequencei758 – 79336NPVNL…SGGGD → GPVNLAVLKLSEQGVLDKLK SKWWYDKGECGSKDSG in isoform Flip and isoform 6.
VSP_053349Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti345 – 3451R → A in CAA41491. 1 Publication
Sequence conflicti375 – 3751G → S in AAA58395. 1 Publication
Sequence conflicti738 – 7381G → E in BAH12004. 1 Publication
Sequence conflicti863 – 8631S → SA in AAA58613. 1 Publication
Sequence conflicti865 – 8673AGA → TAP in AAA58613. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M64752 mRNA. Translation: AAA58613.1.
X58633 mRNA. Translation: CAA41491.1.
M81886 mRNA. Translation: AAA58395.1.
AK295039 mRNA. Translation: BAH11956.1.
AK295184 mRNA. Translation: BAH12004.1.
AK295827 mRNA. Translation: BAH12192.1.
AK315934 mRNA. Translation: BAH14305.1.
AC010613 Genomic DNA. No translation available.
AC025156 Genomic DNA. No translation available.
AC091960 Genomic DNA. No translation available.
AC091962 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61649.1.
CH471062 Genomic DNA. Translation: EAW61650.1.
BC111734 mRNA. Translation: AAI11735.1.
CCDSiCCDS4322.1. [P42261-1]
CCDS47318.1. [P42261-2]
CCDS58986.1. [P42261-3]
CCDS58987.1. [P42261-5]
CCDS58988.1. [P42261-6]
CCDS58989.1. [P42261-4]
PIRiA40222.
A41273.
S25852.
S38723.
RefSeqiNP_000818.2. NM_000827.3. [P42261-1]
NP_001107655.1. NM_001114183.1. [P42261-2]
NP_001244948.1. NM_001258019.1. [P42261-3]
NP_001244950.1. NM_001258021.1. [P42261-5]
NP_001244951.1. NM_001258022.1. [P42261-6]
NP_001244952.1. NM_001258023.1. [P42261-4]
UniGeneiHs.519693.
Hs.737709.

Genome annotation databases

EnsembliENST00000285900; ENSP00000285900; ENSG00000155511. [P42261-1]
ENST00000340592; ENSP00000339343; ENSG00000155511. [P42261-2]
ENST00000448073; ENSP00000415569; ENSG00000155511. [P42261-6]
ENST00000518142; ENSP00000427920; ENSG00000155511. [P42261-3]
ENST00000518783; ENSP00000428994; ENSG00000155511. [P42261-5]
ENST00000521843; ENSP00000427864; ENSG00000155511. [P42261-4]
GeneIDi2890.
KEGGihsa:2890.
UCSCiuc003luy.4. human. [P42261-1]
uc003lva.4. human. [P42261-2]
uc011dcw.2. human.

Polymorphism databases

DMDMi116242505.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M64752 mRNA. Translation: AAA58613.1 .
X58633 mRNA. Translation: CAA41491.1 .
M81886 mRNA. Translation: AAA58395.1 .
AK295039 mRNA. Translation: BAH11956.1 .
AK295184 mRNA. Translation: BAH12004.1 .
AK295827 mRNA. Translation: BAH12192.1 .
AK315934 mRNA. Translation: BAH14305.1 .
AC010613 Genomic DNA. No translation available.
AC025156 Genomic DNA. No translation available.
AC091960 Genomic DNA. No translation available.
AC091962 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61649.1 .
CH471062 Genomic DNA. Translation: EAW61650.1 .
BC111734 mRNA. Translation: AAI11735.1 .
CCDSi CCDS4322.1. [P42261-1 ]
CCDS47318.1. [P42261-2 ]
CCDS58986.1. [P42261-3 ]
CCDS58987.1. [P42261-5 ]
CCDS58988.1. [P42261-6 ]
CCDS58989.1. [P42261-4 ]
PIRi A40222.
A41273.
S25852.
S38723.
RefSeqi NP_000818.2. NM_000827.3. [P42261-1 ]
NP_001107655.1. NM_001114183.1. [P42261-2 ]
NP_001244948.1. NM_001258019.1. [P42261-3 ]
NP_001244950.1. NM_001258021.1. [P42261-5 ]
NP_001244951.1. NM_001258022.1. [P42261-6 ]
NP_001244952.1. NM_001258023.1. [P42261-4 ]
UniGenei Hs.519693.
Hs.737709.

3D structure databases

ProteinModelPortali P42261.
SMRi P42261. Positions 22-831.
ModBasei Search...

Protein-protein interaction databases

BioGridi 109147. 18 interactions.
DIPi DIP-41487N.
MINTi MINT-271172.
STRINGi 9606.ENSP00000285900.

Chemistry

BindingDBi P42261.
ChEMBLi CHEMBL2096670.
DrugBanki DB01189. Desflurane.
DB00228. Enflurane.
DB01159. Halothane.
DB00753. Isoflurane.
DB00142. L-Glutamic Acid.
DB01028. Methoxyflurane.
DB01236. Sevoflurane.
GuidetoPHARMACOLOGYi 444.

PTM databases

PhosphoSitei P42261.

Polymorphism databases

DMDMi 116242505.

Proteomic databases

PaxDbi P42261.
PRIDEi P42261.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000285900 ; ENSP00000285900 ; ENSG00000155511 . [P42261-1 ]
ENST00000340592 ; ENSP00000339343 ; ENSG00000155511 . [P42261-2 ]
ENST00000448073 ; ENSP00000415569 ; ENSG00000155511 . [P42261-6 ]
ENST00000518142 ; ENSP00000427920 ; ENSG00000155511 . [P42261-3 ]
ENST00000518783 ; ENSP00000428994 ; ENSG00000155511 . [P42261-5 ]
ENST00000521843 ; ENSP00000427864 ; ENSG00000155511 . [P42261-4 ]
GeneIDi 2890.
KEGGi hsa:2890.
UCSCi uc003luy.4. human. [P42261-1 ]
uc003lva.4. human. [P42261-2 ]
uc011dcw.2. human.

Organism-specific databases

CTDi 2890.
GeneCardsi GC05P152850.
H-InvDB HIX0032120.
HGNCi HGNC:4571. GRIA1.
HPAi CAB001965.
HPA035202.
MIMi 138248. gene.
neXtProti NX_P42261.
PharmGKBi PA28966.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG316680.
HOGENOMi HOG000234372.
HOVERGENi HBG051839.
KOi K05197.
OMAi FAFFCTS.
OrthoDBi EOG7C2R0J.
PhylomeDBi P42261.
TreeFami TF315232.

Enzyme and pathway databases

Reactomei REACT_18307. Trafficking of AMPA receptors.
REACT_18338. Activation of AMPA receptors.
REACT_18422. Trafficking of GluR2-containing AMPA receptors.
REACT_20594. Unblocking of NMDA receptor, glutamate binding and activation.
SignaLinki P42261.

Miscellaneous databases

GeneWikii GRIA1.
GenomeRNAii 2890.
NextBioi 11425.
PROi P42261.
SOURCEi Search...

Gene expression databases

ArrayExpressi P42261.
Bgeei P42261.
CleanExi HS_GRIA1.
Genevestigatori P42261.

Family and domain databases

InterProi IPR001828. ANF_lig-bd_rcpt.
IPR019594. Glu_rcpt_Glu/Gly-bd.
IPR001320. Iontro_glu_rcpt.
IPR001508. NMDA_rcpt.
IPR028082. Peripla_BP_I.
[Graphical view ]
Pfami PF01094. ANF_receptor. 1 hit.
PF00060. Lig_chan. 1 hit.
PF10613. Lig_chan-Glu_bd. 1 hit.
[Graphical view ]
PRINTSi PR00177. NMDARECEPTOR.
SMARTi SM00918. Lig_chan-Glu_bd. 1 hit.
SM00079. PBPe. 1 hit.
[Graphical view ]
SUPFAMi SSF53822. SSF53822. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and chromosomal localization of one of the human glutamate receptor genes."
    Puckett C., Gomez C.M., Korenberg J.R., Tung H., Meier T.J., Chen X.N., Hood L.E.
    Proc. Natl. Acad. Sci. U.S.A. 88:7557-7561(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM FLIP).
  2. "The human glutamate receptor cDNA GluR1: cloning, sequencing, expression and localization to chromosome 5."
    Potier M.-C., Spillantini M.G., Carter N.P.
    DNA Seq. 2:211-218(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM FLOP).
    Tissue: Hippocampus.
  3. "Molecular cloning, chromosomal mapping, and functional expression of human brain glutamate receptors."
    Sun W., Ferrer-Montiel A.V., Schinder A.F., McPherson J.P., Evans G.A., Montal M.
    Proc. Natl. Acad. Sci. U.S.A. 89:1443-1447(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM FLOP).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5 AND 6).
    Tissue: Brain, Cerebellum and Hippocampus.
  5. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM FLOP).
  8. "Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins."
    Kato A.S., Gill M.B., Ho M.T., Yu H., Tu Y., Siuda E.R., Wang H., Qian Y.W., Nisenbaum E.S., Tomita S., Bredt D.S.
    Neuron 68:1082-1096(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  9. "Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating."
    Shi Y., Suh Y.H., Milstein A.D., Isozaki K., Schmid S.M., Roche K.W., Nicoll R.A.
    Proc. Natl. Acad. Sci. U.S.A. 107:16315-16319(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CNIH2 AND CACNG2.
  10. "A eukaryotic specific transmembrane segment is required for tetramerization in AMPA receptors."
    Salussolia C.L., Gan Q., Kazi R., Singh P., Allopenna J., Furukawa H., Wollmuth L.P.
    J. Neurosci. 33:9840-9845(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBUNIT, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiGRIA1_HUMAN
AccessioniPrimary (citable) accession number: P42261
Secondary accession number(s): B7Z2S0
, B7Z2W8, B7Z3F6, B7Z9G9, D3DQI4, E7ESV8, Q2NKM6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: October 17, 2006
Last modified: September 3, 2014
This is version 155 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds AMPA (quisqualate) > glutamate > kainate.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi