Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P42261

- GRIA1_HUMAN

UniProt

P42261 - GRIA1_HUMAN

Protein

Glutamate receptor 1

Gene

GRIA1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 156 (01 Oct 2014)
      Sequence version 2 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.2 Publications

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei464 – 4641GlutamateBy similarity
    Binding sitei499 – 4991GlutamateBy similarity
    Binding sitei719 – 7191GlutamateBy similarity

    GO - Molecular functioni

    1. alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity Source: UniProtKB
    2. extracellular-glutamate-gated ion channel activity Source: RefGenome
    3. glutamate receptor activity Source: ProtInc
    4. PDZ domain binding Source: BHF-UCL
    5. protein binding Source: UniProtKB

    GO - Biological processi

    1. ionotropic glutamate receptor signaling pathway Source: GOC
    2. ion transmembrane transport Source: GOC
    3. long-term memory Source: Ensembl
    4. receptor internalization Source: Ensembl
    5. signal transduction Source: ProtInc
    6. synaptic transmission Source: Reactome
    7. synaptic transmission, glutamatergic Source: RefGenome

    Keywords - Molecular functioni

    Ion channel, Ligand-gated ion channel, Receptor

    Keywords - Biological processi

    Ion transport, Transport

    Enzyme and pathway databases

    ReactomeiREACT_18307. Trafficking of AMPA receptors.
    REACT_18338. Activation of AMPA receptors.
    REACT_18422. Trafficking of GluR2-containing AMPA receptors.
    REACT_20594. Unblocking of NMDA receptor, glutamate binding and activation.
    SignaLinkiP42261.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Glutamate receptor 1
    Short name:
    GluR-1
    Alternative name(s):
    AMPA-selective glutamate receptor 1
    GluR-A
    GluR-K1
    Glutamate receptor ionotropic, AMPA 1
    Short name:
    GluA1
    Gene namesi
    Name:GRIA1
    Synonyms:GLUH1, GLUR1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:4571. GRIA1.

    Subcellular locationi

    Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication. Endoplasmic reticulum membrane By similarity; Multi-pass membrane protein By similarity. Cell junctionsynapsepostsynaptic cell membrane 1 Publication; Multi-pass membrane protein 1 Publication. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell projectiondendrite By similarity. Cell projectiondendritic spine By similarity
    Note: Interaction with CACNG2, CNIH2 and CNIH3 promotes cell surface expression.By similarity

    GO - Cellular componenti

    1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: UniProtKB
    2. cell junction Source: UniProtKB-KW
    3. cell surface Source: BHF-UCL
    4. dendrite Source: UniProtKB
    5. dendrite membrane Source: Ensembl
    6. dendritic spine Source: UniProtKB
    7. endocytic vesicle membrane Source: Reactome
    8. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    9. neuronal cell body Source: BHF-UCL
    10. neuron spine Source: BHF-UCL
    11. plasma membrane Source: Reactome
    12. postsynaptic density Source: UniProtKB
    13. postsynaptic membrane Source: RefGenome
    14. synaptic vesicle Source: Ensembl

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cell projection, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA28966.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1818Sequence AnalysisAdd
    BLAST
    Chaini19 – 906888Glutamate receptor 1PRO_0000011529Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi63 – 631N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi75 ↔ 323By similarity
    Glycosylationi249 – 2491N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi257 – 2571N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi363 – 3631N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi401 – 4011N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi406 – 4061N-linked (GlcNAc...)Sequence Analysis
    Lipidationi603 – 6031S-palmitoyl cysteineBy similarity
    Modified residuei645 – 6451PhosphoserineBy similarity
    Modified residuei710 – 7101PhosphoserineBy similarity
    Disulfide bondi732 ↔ 787By similarity
    Lipidationi829 – 8291S-palmitoyl cysteineBy similarity
    Modified residuei849 – 8491PhosphoserineBy similarity
    Modified residuei863 – 8631PhosphoserineBy similarity

    Post-translational modificationi

    Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-603 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-829 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis By similarity.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

    Proteomic databases

    PaxDbiP42261.
    PRIDEiP42261.

    PTM databases

    PhosphoSiteiP42261.

    Expressioni

    Tissue specificityi

    Widely expressed in brain.

    Gene expression databases

    ArrayExpressiP42261.
    BgeeiP42261.
    CleanExiHS_GRIA1.
    GenevestigatoriP42261.

    Organism-specific databases

    HPAiCAB001965.
    HPA035202.

    Interactioni

    Subunit structurei

    Homotetramer or heterotetramer of pore-forming glutamate receptor subunits. Tetramers may be formed by the dimerization of dimers. Interacts with DLG1 via its C-terminus. Found in a complex with GRIA2, GRIA3, GRIA4, CNIH2, CNIH3, CACNG2, CACNG3, CACNG4, CACNG5, CACNG7 and CACNG8. Interacts with HIP1, RASGRF2, SYNDIG1 and LRFN1. Interacts with SNX27 (via PDZ domain); the interaction is required for recycling to the plasma membrane when endocytosed and prevent degradation in lysosomes. Interacts (via PDZ-binding motif) with SHANK3 (via PDZ domain).2 Publications

    Protein-protein interaction databases

    BioGridi109147. 18 interactions.
    DIPiDIP-41487N.
    MINTiMINT-271172.
    STRINGi9606.ENSP00000285900.

    Structurei

    3D structure databases

    ProteinModelPortaliP42261.
    SMRiP42261. Positions 22-831.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini19 – 536518ExtracellularBy similarityAdd
    BLAST
    Topological domaini558 – 58427CytoplasmicBy similarityAdd
    BLAST
    Topological domaini604 – 6096CytoplasmicBy similarity
    Topological domaini631 – 805175ExtracellularBy similarityAdd
    BLAST
    Topological domaini827 – 90680CytoplasmicBy similarityAdd
    BLAST

    Intramembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Intramembranei585 – 60016Helical; Pore-formingBy similarityAdd
    BLAST
    Intramembranei601 – 6033By similarity

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei537 – 55721HelicalBy similarityAdd
    BLAST
    Transmembranei610 – 63021HelicalBy similarityAdd
    BLAST
    Transmembranei806 – 82621Helical; Name=M4Add
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni492 – 4943Glutamate bindingBy similarity
    Regioni668 – 6692Glutamate bindingBy similarity

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi903 – 9064PDZ-binding

    Domaini

    The M4 transmembrane segment mediates tetramerization and is required for cell surface expression.

    Sequence similaritiesi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG316680.
    HOGENOMiHOG000234372.
    HOVERGENiHBG051839.
    KOiK05197.
    OMAiFAFFCTS.
    OrthoDBiEOG7C2R0J.
    PhylomeDBiP42261.
    TreeFamiTF315232.

    Family and domain databases

    InterProiIPR001828. ANF_lig-bd_rcpt.
    IPR019594. Glu_rcpt_Glu/Gly-bd.
    IPR001320. Iontro_glu_rcpt.
    IPR001508. NMDA_rcpt.
    IPR028082. Peripla_BP_I.
    [Graphical view]
    PfamiPF01094. ANF_receptor. 1 hit.
    PF00060. Lig_chan. 1 hit.
    PF10613. Lig_chan-Glu_bd. 1 hit.
    [Graphical view]
    PRINTSiPR00177. NMDARECEPTOR.
    SMARTiSM00918. Lig_chan-Glu_bd. 1 hit.
    SM00079. PBPe. 1 hit.
    [Graphical view]
    SUPFAMiSSF53822. SSF53822. 1 hit.

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform Flop (identifier: P42261-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQHIFAFFCT GFLGAVVGAN FPNNIQIGGL FPNQQSQEHA AFRFALSQLT    50
    EPPKLLPQID IVNISDSFEM TYRFCSQFSK GVYAIFGFYE RRTVNMLTSF 100
    CGALHVCFIT PSFPVDTSNQ FVLQLRPELQ DALISIIDHY KWQKFVYIYD 150
    ADRGLSVLQK VLDTAAEKNW QVTAVNILTT TEEGYRMLFQ DLEKKKERLV 200
    VVDCESERLN AILGQIIKLE KNGIGYHYIL ANLGFMDIDL NKFKESGANV 250
    TGFQLVNYTD TIPAKIMQQW KNSDARDHTR VDWKRPKYTS ALTYDGVKVM 300
    AEAFQSLRRQ RIDISRRGNA GDCLANPAVP WGQGIDIQRA LQQVRFEGLT 350
    GNVQFNEKGR RTNYTLHVIE MKHDGIRKIG YWNEDDKFVP AATDAQAGGD 400
    NSSVQNRTYI VTTILEDPYV MLKKNANQFE GNDRYEGYCV ELAAEIAKHV 450
    GYSYRLEIVS DGKYGARDPD TKAWNGMVGE LVYGRADVAV APLTITLVRE 500
    EVIDFSKPFM SLGISIMIKK PQKSKPGVFS FLDPLAYEIW MCIVFAYIGV 550
    SVVLFLVSRF SPYEWHSEEF EEGRDQTTSD QSNEFGIFNS LWFSLGAFMQ 600
    QGCDISPRSL SGRIVGGVWW FFTLIIISSY TANLAAFLTV ERMVSPIESA 650
    EDLAKQTEIA YGTLEAGSTK EFFRRSKIAV FEKMWTYMKS AEPSVFVRTT 700
    EEGMIRVRKS KGKYAYLLES TMNEYIEQRK PCDTMKVGGN LDSKGYGIAT 750
    PKGSALRNPV NLAVLKLNEQ GLLDKLKNKW WYDKGECGSG GGDSKDKTSA 800
    LSLSNVAGVF YILIGGLGLA MLVALIEFCY KSRSESKRMK GFCLIPQQSI 850
    NEAIRTSTLP RNSGAGASSG GSGENGRVVS HDFPKSMQSI PCMSHSSGMP 900
    LGATGL 906
    Length:906
    Mass (Da):101,506
    Last modified:October 17, 2006 - v2
    Checksum:i03EA1E026D0A9A2F
    GO
    Isoform Flip (identifier: P42261-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         758-793: NPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGD → GPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSG

    Show »
    Length:906
    Mass (Da):101,482
    Checksum:i4C1973DBFE98C979
    GO
    Isoform 3 (identifier: P42261-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         74-154: FCSQFSKGVY...FVYIYDADRG → C

    Show »
    Length:826
    Mass (Da):92,172
    Checksum:i53F69105FB85CFC9
    GO
    Isoform 4 (identifier: P42261-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-69: Missing.

    Show »
    Length:837
    Mass (Da):93,900
    Checksum:i54246EAC4BFFB9F0
    GO
    Isoform 5 (identifier: P42261-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-28: MQHIFAFFCTGFLGAVVGANFPNNIQIG → MCCSTHLFQPLQLAGGLEWPWSNLLCFLTPVKLHPEVW

    Note: No experimental confirmation available.

    Show »
    Length:916
    Mass (Da):102,888
    Checksum:iC49F9C13D74EC7E3
    GO
    Isoform 6 (identifier: P42261-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-28: MQHIFAFFCTGFLGAVVGANFPNNIQIG → MCCSTHLFQPLQLAGGLEWPWSNLLCFLTPVKLHPEVW
         758-793: NPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGD → GPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSG

    Note: No experimental confirmation available.

    Show »
    Length:916
    Mass (Da):102,864
    Checksum:i8B6CF1CA44DC94B5
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti345 – 3451R → A in CAA41491. (PubMed:1320959)Curated
    Sequence conflicti375 – 3751G → S in AAA58395. (PubMed:1311100)Curated
    Sequence conflicti738 – 7381G → E in BAH12004. (PubMed:14702039)Curated
    Sequence conflicti863 – 8631S → SA in AAA58613. (PubMed:1652753)Curated
    Sequence conflicti865 – 8673AGA → TAP in AAA58613. (PubMed:1652753)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti487 – 4871D → N.
    Corresponds to variant rs13166146 [ dbSNP | Ensembl ].
    VAR_028071
    Natural varianti521 – 5211P → T.
    Corresponds to variant rs13166161 [ dbSNP | Ensembl ].
    VAR_028072
    Natural varianti536 – 5361A → S.
    Corresponds to variant rs13166438 [ dbSNP | Ensembl ].
    VAR_028073
    Natural varianti548 – 5481I → M.
    Corresponds to variant rs13186241 [ dbSNP | Ensembl ].
    VAR_028074
    Natural varianti588 – 5881F → L.
    Corresponds to variant rs13186534 [ dbSNP | Ensembl ].
    VAR_028075

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6969Missing in isoform 4. 1 PublicationVSP_045119Add
    BLAST
    Alternative sequencei1 – 2828MQHIF…NIQIG → MCCSTHLFQPLQLAGGLEWP WSNLLCFLTPVKLHPEVW in isoform 5 and isoform 6. 1 PublicationVSP_047024Add
    BLAST
    Alternative sequencei74 – 15481FCSQF…DADRG → C in isoform 3. 1 PublicationVSP_045120Add
    BLAST
    Alternative sequencei758 – 79336NPVNL…SGGGD → GPVNLAVLKLSEQGVLDKLK SKWWYDKGECGSKDSG in isoform Flip and isoform 6. 2 PublicationsVSP_053349Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M64752 mRNA. Translation: AAA58613.1.
    X58633 mRNA. Translation: CAA41491.1.
    M81886 mRNA. Translation: AAA58395.1.
    AK295039 mRNA. Translation: BAH11956.1.
    AK295184 mRNA. Translation: BAH12004.1.
    AK295827 mRNA. Translation: BAH12192.1.
    AK315934 mRNA. Translation: BAH14305.1.
    AC010613 Genomic DNA. No translation available.
    AC025156 Genomic DNA. No translation available.
    AC091960 Genomic DNA. No translation available.
    AC091962 Genomic DNA. No translation available.
    CH471062 Genomic DNA. Translation: EAW61649.1.
    CH471062 Genomic DNA. Translation: EAW61650.1.
    BC111734 mRNA. Translation: AAI11735.1.
    CCDSiCCDS4322.1. [P42261-1]
    CCDS47318.1. [P42261-2]
    CCDS58986.1. [P42261-3]
    CCDS58987.1. [P42261-5]
    CCDS58988.1. [P42261-6]
    CCDS58989.1. [P42261-4]
    PIRiA40222.
    A41273.
    S25852.
    S38723.
    RefSeqiNP_000818.2. NM_000827.3. [P42261-1]
    NP_001107655.1. NM_001114183.1. [P42261-2]
    NP_001244948.1. NM_001258019.1. [P42261-3]
    NP_001244950.1. NM_001258021.1. [P42261-5]
    NP_001244951.1. NM_001258022.1. [P42261-6]
    NP_001244952.1. NM_001258023.1. [P42261-4]
    UniGeneiHs.519693.
    Hs.737709.

    Genome annotation databases

    EnsembliENST00000285900; ENSP00000285900; ENSG00000155511. [P42261-1]
    ENST00000340592; ENSP00000339343; ENSG00000155511. [P42261-2]
    ENST00000448073; ENSP00000415569; ENSG00000155511. [P42261-6]
    ENST00000518142; ENSP00000427920; ENSG00000155511. [P42261-3]
    ENST00000518783; ENSP00000428994; ENSG00000155511. [P42261-5]
    ENST00000521843; ENSP00000427864; ENSG00000155511. [P42261-4]
    GeneIDi2890.
    KEGGihsa:2890.
    UCSCiuc003luy.4. human. [P42261-1]
    uc003lva.4. human. [P42261-2]
    uc011dcw.2. human.

    Polymorphism databases

    DMDMi116242505.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M64752 mRNA. Translation: AAA58613.1 .
    X58633 mRNA. Translation: CAA41491.1 .
    M81886 mRNA. Translation: AAA58395.1 .
    AK295039 mRNA. Translation: BAH11956.1 .
    AK295184 mRNA. Translation: BAH12004.1 .
    AK295827 mRNA. Translation: BAH12192.1 .
    AK315934 mRNA. Translation: BAH14305.1 .
    AC010613 Genomic DNA. No translation available.
    AC025156 Genomic DNA. No translation available.
    AC091960 Genomic DNA. No translation available.
    AC091962 Genomic DNA. No translation available.
    CH471062 Genomic DNA. Translation: EAW61649.1 .
    CH471062 Genomic DNA. Translation: EAW61650.1 .
    BC111734 mRNA. Translation: AAI11735.1 .
    CCDSi CCDS4322.1. [P42261-1 ]
    CCDS47318.1. [P42261-2 ]
    CCDS58986.1. [P42261-3 ]
    CCDS58987.1. [P42261-5 ]
    CCDS58988.1. [P42261-6 ]
    CCDS58989.1. [P42261-4 ]
    PIRi A40222.
    A41273.
    S25852.
    S38723.
    RefSeqi NP_000818.2. NM_000827.3. [P42261-1 ]
    NP_001107655.1. NM_001114183.1. [P42261-2 ]
    NP_001244948.1. NM_001258019.1. [P42261-3 ]
    NP_001244950.1. NM_001258021.1. [P42261-5 ]
    NP_001244951.1. NM_001258022.1. [P42261-6 ]
    NP_001244952.1. NM_001258023.1. [P42261-4 ]
    UniGenei Hs.519693.
    Hs.737709.

    3D structure databases

    ProteinModelPortali P42261.
    SMRi P42261. Positions 22-831.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 109147. 18 interactions.
    DIPi DIP-41487N.
    MINTi MINT-271172.
    STRINGi 9606.ENSP00000285900.

    Chemistry

    BindingDBi P42261.
    ChEMBLi CHEMBL2096670.
    DrugBanki DB01189. Desflurane.
    DB00228. Enflurane.
    DB01159. Halothane.
    DB00753. Isoflurane.
    DB00142. L-Glutamic Acid.
    DB01028. Methoxyflurane.
    DB01236. Sevoflurane.
    GuidetoPHARMACOLOGYi 444.

    PTM databases

    PhosphoSitei P42261.

    Polymorphism databases

    DMDMi 116242505.

    Proteomic databases

    PaxDbi P42261.
    PRIDEi P42261.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000285900 ; ENSP00000285900 ; ENSG00000155511 . [P42261-1 ]
    ENST00000340592 ; ENSP00000339343 ; ENSG00000155511 . [P42261-2 ]
    ENST00000448073 ; ENSP00000415569 ; ENSG00000155511 . [P42261-6 ]
    ENST00000518142 ; ENSP00000427920 ; ENSG00000155511 . [P42261-3 ]
    ENST00000518783 ; ENSP00000428994 ; ENSG00000155511 . [P42261-5 ]
    ENST00000521843 ; ENSP00000427864 ; ENSG00000155511 . [P42261-4 ]
    GeneIDi 2890.
    KEGGi hsa:2890.
    UCSCi uc003luy.4. human. [P42261-1 ]
    uc003lva.4. human. [P42261-2 ]
    uc011dcw.2. human.

    Organism-specific databases

    CTDi 2890.
    GeneCardsi GC05P152850.
    H-InvDB HIX0032120.
    HGNCi HGNC:4571. GRIA1.
    HPAi CAB001965.
    HPA035202.
    MIMi 138248. gene.
    neXtProti NX_P42261.
    PharmGKBi PA28966.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG316680.
    HOGENOMi HOG000234372.
    HOVERGENi HBG051839.
    KOi K05197.
    OMAi FAFFCTS.
    OrthoDBi EOG7C2R0J.
    PhylomeDBi P42261.
    TreeFami TF315232.

    Enzyme and pathway databases

    Reactomei REACT_18307. Trafficking of AMPA receptors.
    REACT_18338. Activation of AMPA receptors.
    REACT_18422. Trafficking of GluR2-containing AMPA receptors.
    REACT_20594. Unblocking of NMDA receptor, glutamate binding and activation.
    SignaLinki P42261.

    Miscellaneous databases

    GeneWikii GRIA1.
    GenomeRNAii 2890.
    NextBioi 11425.
    PROi P42261.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P42261.
    Bgeei P42261.
    CleanExi HS_GRIA1.
    Genevestigatori P42261.

    Family and domain databases

    InterProi IPR001828. ANF_lig-bd_rcpt.
    IPR019594. Glu_rcpt_Glu/Gly-bd.
    IPR001320. Iontro_glu_rcpt.
    IPR001508. NMDA_rcpt.
    IPR028082. Peripla_BP_I.
    [Graphical view ]
    Pfami PF01094. ANF_receptor. 1 hit.
    PF00060. Lig_chan. 1 hit.
    PF10613. Lig_chan-Glu_bd. 1 hit.
    [Graphical view ]
    PRINTSi PR00177. NMDARECEPTOR.
    SMARTi SM00918. Lig_chan-Glu_bd. 1 hit.
    SM00079. PBPe. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53822. SSF53822. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and chromosomal localization of one of the human glutamate receptor genes."
      Puckett C., Gomez C.M., Korenberg J.R., Tung H., Meier T.J., Chen X.N., Hood L.E.
      Proc. Natl. Acad. Sci. U.S.A. 88:7557-7561(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM FLIP).
    2. "The human glutamate receptor cDNA GluR1: cloning, sequencing, expression and localization to chromosome 5."
      Potier M.-C., Spillantini M.G., Carter N.P.
      DNA Seq. 2:211-218(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM FLOP).
      Tissue: Hippocampus.
    3. "Molecular cloning, chromosomal mapping, and functional expression of human brain glutamate receptors."
      Sun W., Ferrer-Montiel A.V., Schinder A.F., McPherson J.P., Evans G.A., Montal M.
      Proc. Natl. Acad. Sci. U.S.A. 89:1443-1447(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM FLOP).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5 AND 6).
      Tissue: Brain, Cerebellum and Hippocampus.
    5. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM FLOP).
    8. "Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins."
      Kato A.S., Gill M.B., Ho M.T., Yu H., Tu Y., Siuda E.R., Wang H., Qian Y.W., Nisenbaum E.S., Tomita S., Bredt D.S.
      Neuron 68:1082-1096(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    9. "Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating."
      Shi Y., Suh Y.H., Milstein A.D., Isozaki K., Schmid S.M., Roche K.W., Nicoll R.A.
      Proc. Natl. Acad. Sci. U.S.A. 107:16315-16319(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CNIH2 AND CACNG2.
    10. "A eukaryotic specific transmembrane segment is required for tetramerization in AMPA receptors."
      Salussolia C.L., Gan Q., Kazi R., Singh P., Allopenna J., Furukawa H., Wollmuth L.P.
      J. Neurosci. 33:9840-9845(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBUNIT, SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiGRIA1_HUMAN
    AccessioniPrimary (citable) accession number: P42261
    Secondary accession number(s): B7Z2S0
    , B7Z2W8, B7Z3F6, B7Z9G9, D3DQI4, E7ESV8, Q2NKM6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1995
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 156 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds AMPA (quisqualate) > glutamate > kainate.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3