Reviewed,
UniProtKB/Swiss-Prot P41992 (PGTB2_CAEEL)
Last modified
November 3, 2009.
Version 68.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Probable geranylgeranyl transferase type-2 subunit beta EC=2.5.1.60 Alternative name(s): Geranylgeranyl transferase type II subunit beta Short name=GGTase-II-beta Type II protein geranyl-geranyltransferase subunit beta Rab geranylgeranyltransferase subunit beta Rab geranyl-geranyltransferase subunit beta Short name=Rab GG transferase beta Short name=Rab GGTase beta | ||
| Gene names |
| ||
| Organism | Caenorhabditis elegans [Complete proteome] | ||
| Taxonomic identifier | 6239 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis |
Protein attributes
| Sequence length | 335 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal By similarity. |
| Catalytic activity | Geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subunit structure | Heterodimer of an alpha and a beta subunit By similarity. |
| Sequence similarities | Belongs to the protein prenyltransferase subunit beta family. Contains 5 PFTB repeats. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Ligand | Metal-binding Zinc |
| Molecular function | Prenyltransferase Transferase |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cell death Inferred from mutant phenotype. Source: WormBase embryonic development ending in birth or egg hatchingInferred from mutant phenotype. Source: WormBase reproductionInferred from mutant phenotype. Source: WormBase |
| Molecular function | Rab geranylgeranyltransferase activity Inferred from electronic annotation. Source: EC zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform a (identifier: P41992-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform b (identifier: P41992-2) The sequence of this isoform differs from the canonical sequence as follows: 292-330: ADPFHTVFGIAALSLFGDDTLESVDPIFCMTKRCLGDKQ → VSFLNNIQKFIFVLQSNNVLATTKQLFECSFNNS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 335 | 335 | Probable geranylgeranyl transferase type-2 subunit beta | PRO_0000119766 | |||||
Regions | |||||||||
| Repeat | 74 – 115 | 42 | PFTB 1 | ||||||
| Repeat | 122 – 163 | 42 | PFTB 2 | ||||||
| Repeat | 170 – 211 | 42 | PFTB 3 | ||||||
| Repeat | 218 – 259 | 42 | PFTB 4 | ||||||
| Repeat | 266 – 312 | 47 | PFTB 5 | ||||||
Sites | |||||||||
| Metal binding | 244 | 1 | Zinc By similarity | ||||||
| Metal binding | 246 | 1 | Zinc By similarity | ||||||
| Metal binding | 296 | 1 | Zinc By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 292 – 330 | 39 | ADPFH…LGDKQ → VSFLNNIQKFIFVLQSNNVL ATTKQLFECSFNNS in isoform b. | VSP_018160 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Genome sequence of the nematode C. elegans: a platform for investigating biology." The C. elegans sequencing consortium Science 282:2012-2018(1998) [PubMed: 9851916] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING. Strain: Bristol N2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U10438 Genomic DNA. Translation: AAL50321.1. U10438 Genomic DNA. Translation: ABB88244.1. | |
| RefSeq | NP_498559.1. NP_741214.2. |
| UniGene | Cel.10970 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1LTX based on UniProtKB Q08603. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P41992. |
Proteomic databases | |
| PRIDE | P41992. |
Genome annotation databases | |
| Ensembl | B0280.1a; B0280.1a; B0280.1; Caenorhabditis elegans. [Genome view] B0280.1b; B0280.1b; B0280.1; Caenorhabditis elegans. [Genome view] |
| GeneID | 175998. |
| KEGG | cel:B0280.1. |
| UCSC | B0280.1a. c. elegans. |
Organism-specific databases | |
| CTD | 175998. |
| WormBase | WBGene00015099. B0280.1. |
| WormPep | B0280.1a. CE24762. [WorfDB] B0280.1b. CE00735. [WorfDB] |
Phylogenomic databases | |
| OMA | YWGLTAL. |
Enzyme and pathway databases | |
| BRENDA | 2.5.1.58. 672. |
Gene expression databases | |
| ArrayExpress | P41992. |
Family and domain databases | |
| InterPro | IPR001330. Prenyltrans. [Graphical view] |
| Pfam | PF00432. Prenyltrans. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 890666. |
Entry information
| Entry name | PGTB2_CAEEL | ||||||||
| Accession | Primary (citable) accession number: P41992 Secondary accession number(s): Q2V4X4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Caenorhabditis annotation project | ||||||||
Relevant documents
| Caenorhabditis elegans Caenorhabditis elegans: entries, gene names and cross-references to WormPep |
| SIMILARITY comments Index of protein domains and families |

Clusters with


