Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P41498

- PPAC_RAT

UniProt

P41498 - PPAC_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Low molecular weight phosphotyrosine protein phosphatase

Gene

Acp1

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates.

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
A phosphate monoester + H2O = an alcohol + phosphate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei13 – 131NucleophileBy similarity
Active sitei19 – 191By similarity
Active sitei130 – 1301Proton donorBy similarity

GO - Molecular functioni

  1. acid phosphatase activity Source: RGD
  2. non-membrane spanning protein tyrosine phosphatase activity Source: InterPro
  3. protein tyrosine phosphatase activity Source: RGD
  4. SH3 domain binding Source: RGD

GO - Biological processi

  1. peptidyl-tyrosine dephosphorylation Source: GOC
  2. synaptic transmission Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Names & Taxonomyi

Protein namesi
Recommended name:
Low molecular weight phosphotyrosine protein phosphatase (EC:3.1.3.48)
Short name:
LMW-PTP
Short name:
LMW-PTPase
Alternative name(s):
Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2)
Gene namesi
Name:Acp1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi2020. Acp1.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. neuron projection Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 158157Low molecular weight phosphotyrosine protein phosphatasePRO_0000046561Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication
Modified residuei132 – 1321PhosphotyrosineBy similarity
Modified residuei133 – 1331PhosphotyrosineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiP41498.
PRIDEiP41498.

PTM databases

PhosphoSiteiP41498.

Expressioni

Gene expression databases

GenevestigatoriP41498.

Interactioni

Subunit structurei

Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1 (By similarity). Isoform 1 interacts with the SH3 domain of SPTAN1.By similarity1 Publication

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000007287.

Structurei

3D structure databases

ProteinModelPortaliP41498.
SMRiP41498. Positions 2-158.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0394.
HOGENOMiHOG000273094.
HOVERGENiHBG007540.
InParanoidiP41498.
KOiK14394.
OrthoDBiEOG7QZGCG.
PhylomeDBiP41498.
TreeFamiTF353727.

Family and domain databases

InterProiIPR023485. Ptyr_pPase_SF.
IPR002115. Tyr_Pase_low_mol_wt_mml.
IPR000106. Tyr_phospatase/Ars_reductase.
IPR017867. Tyr_phospatase_low_mol_wt.
[Graphical view]
PANTHERiPTHR11717:SF15. PTHR11717:SF15. 1 hit.
PfamiPF01451. LMWPc. 1 hit.
[Graphical view]
PRINTSiPR00719. LMWPTPASE.
PR00720. MAMMALPTPASE.
SMARTiSM00226. LMWPc. 1 hit.
[Graphical view]
SUPFAMiSSF52788. SSF52788. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: P41498-1) [UniParc]FASTAAdd to Basket

Also known as: ACP1, A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEVGSKSVL FVCLGNICRS PIAEAVFRKL VTDENVSDNW RIDSAATSTY
60 70 80 90 100
EVGNPPDYRG QNCMKKHGIH MQHIARQITR EDFATFDYIL CMDESNLRDL
110 120 130 140 150
NRKSNQVKNC KAKIELLGSY DPQKQLIIED PYYGNDSDFE VVYQQCLRCC

KAFLEKTH
Length:158
Mass (Da):18,152
Last modified:January 23, 2007 - v3
Checksum:i5C454D4DA82FB094
GO
Isoform 2 (identifier: P41498-2) [UniParc]FASTAAdd to Basket

Also known as: ACP2, B

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: RIDSAATSTYEVGNPPDYRGQNCMKKHGIHMQHI → AIDSSAVSDWNVGRPPDPRAVNCLRNHGISTAHK

Show »
Length:158
Mass (Da):17,937
Checksum:i9BA17AFBC38AC8F6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti2 – 21A → ACA AA sequence (PubMed:1388675)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei41 – 7434RIDSA…HMQHI → AIDSSAVSDWNVGRPPDPRA VNCLRNHGISTAHK in isoform 2. 1 PublicationVSP_004705Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF171072 mRNA. Translation: AAD50990.1.
BC062229 mRNA. Translation: AAH62229.1.
PIRiA53874.
RefSeqiNP_067085.1. NM_021262.2. [P41498-1]
UniGeneiRn.108187.
Rn.154499.
Rn.202830.

Genome annotation databases

GeneIDi24161.
KEGGirno:24161.
UCSCiRGD:2020. rat. [P41498-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF171072 mRNA. Translation: AAD50990.1 .
BC062229 mRNA. Translation: AAH62229.1 .
PIRi A53874.
RefSeqi NP_067085.1. NM_021262.2. [P41498-1 ]
UniGenei Rn.108187.
Rn.154499.
Rn.202830.

3D structure databases

ProteinModelPortali P41498.
SMRi P41498. Positions 2-158.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10116.ENSRNOP00000007287.

PTM databases

PhosphoSitei P41498.

Proteomic databases

PaxDbi P41498.
PRIDEi P41498.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 24161.
KEGGi rno:24161.
UCSCi RGD:2020. rat. [P41498-1 ]

Organism-specific databases

CTDi 52.
RGDi 2020. Acp1.

Phylogenomic databases

eggNOGi COG0394.
HOGENOMi HOG000273094.
HOVERGENi HBG007540.
InParanoidi P41498.
KOi K14394.
OrthoDBi EOG7QZGCG.
PhylomeDBi P41498.
TreeFami TF353727.

Miscellaneous databases

NextBioi 602457.
PROi P41498.

Gene expression databases

Genevestigatori P41498.

Family and domain databases

InterProi IPR023485. Ptyr_pPase_SF.
IPR002115. Tyr_Pase_low_mol_wt_mml.
IPR000106. Tyr_phospatase/Ars_reductase.
IPR017867. Tyr_phospatase_low_mol_wt.
[Graphical view ]
PANTHERi PTHR11717:SF15. PTHR11717:SF15. 1 hit.
Pfami PF01451. LMWPc. 1 hit.
[Graphical view ]
PRINTSi PR00719. LMWPTPASE.
PR00720. MAMMALPTPASE.
SMARTi SM00226. LMWPc. 1 hit.
[Graphical view ]
SUPFAMi SSF52788. SSF52788. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH SPTAN1.
    Strain: Sprague-Dawley.
    Tissue: Kidney.
  2. "Rat liver low M(r) phosphotyrosine protein phosphatase isoenzymes: purification and amino acid sequences."
    Manao G., Pazzagli L., Cirri P., Caselli A., Camici G., Cappugi G., Saeed A., Ramponi G.
    J. Protein Chem. 11:333-345(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE (ISOFORMS 1 AND 2), CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2.
    Tissue: Liver.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Pituitary.
  4. Lubec G., Afjehi-Sadat L., Diao W.
    Submitted (APR-2007) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 20-28; 42-59 AND 114-124, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: Sprague-Dawley.
    Tissue: Hippocampus and Spinal cord.

Entry informationi

Entry nameiPPAC_RAT
AccessioniPrimary (citable) accession number: P41498
Secondary accession number(s): Q9R138
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: January 23, 2007
Last modified: October 29, 2014
This is version 121 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3