Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P41498

- PPAC_RAT

UniProt

P41498 - PPAC_RAT

Protein

Low molecular weight phosphotyrosine protein phosphatase

Gene

Acp1

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 3 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates.

    Catalytic activityi

    Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
    A phosphate monoester + H2O = an alcohol + phosphate.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei13 – 131NucleophileBy similarity
    Active sitei19 – 191By similarity
    Active sitei130 – 1301Proton donorBy similarity

    GO - Molecular functioni

    1. acid phosphatase activity Source: RGD
    2. non-membrane spanning protein tyrosine phosphatase activity Source: InterPro
    3. protein tyrosine phosphatase activity Source: RGD
    4. SH3 domain binding Source: RGD

    GO - Biological processi

    1. peptidyl-tyrosine dephosphorylation Source: GOC
    2. synaptic transmission Source: RGD

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Low molecular weight phosphotyrosine protein phosphatase (EC:3.1.3.48)
    Short name:
    LMW-PTP
    Short name:
    LMW-PTPase
    Alternative name(s):
    Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2)
    Gene namesi
    Name:Acp1
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi2020. Acp1.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. neuron projection Source: RGD

    Keywords - Cellular componenti

    Cytoplasm

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 158157Low molecular weight phosphotyrosine protein phosphatasePRO_0000046561Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication
    Modified residuei132 – 1321PhosphotyrosineBy similarity
    Modified residuei133 – 1331PhosphotyrosineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    PaxDbiP41498.
    PRIDEiP41498.

    PTM databases

    PhosphoSiteiP41498.

    Expressioni

    Gene expression databases

    GenevestigatoriP41498.

    Interactioni

    Subunit structurei

    Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1 By similarity. Isoform 1 interacts with the SH3 domain of SPTAN1.By similarity1 Publication

    Protein-protein interaction databases

    STRINGi10116.ENSRNOP00000007287.

    Structurei

    3D structure databases

    ProteinModelPortaliP41498.
    SMRiP41498. Positions 2-158.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG0394.
    HOGENOMiHOG000273094.
    HOVERGENiHBG007540.
    InParanoidiP41498.
    KOiK14394.
    OrthoDBiEOG7QZGCG.
    PhylomeDBiP41498.
    TreeFamiTF353727.

    Family and domain databases

    InterProiIPR023485. Ptyr_pPase_SF.
    IPR002115. Tyr_Pase_low_mol_wt_mml.
    IPR000106. Tyr_phospatase/Ars_reductase.
    IPR017867. Tyr_phospatase_low_mol_wt.
    [Graphical view]
    PANTHERiPTHR11717. PTHR11717. 1 hit.
    PfamiPF01451. LMWPc. 1 hit.
    [Graphical view]
    PRINTSiPR00719. LMWPTPASE.
    PR00720. MAMMALPTPASE.
    SMARTiSM00226. LMWPc. 1 hit.
    [Graphical view]
    SUPFAMiSSF52788. SSF52788. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: P41498-1) [UniParc]FASTAAdd to Basket

    Also known as: ACP1, A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAEVGSKSVL FVCLGNICRS PIAEAVFRKL VTDENVSDNW RIDSAATSTY    50
    EVGNPPDYRG QNCMKKHGIH MQHIARQITR EDFATFDYIL CMDESNLRDL 100
    NRKSNQVKNC KAKIELLGSY DPQKQLIIED PYYGNDSDFE VVYQQCLRCC 150
    KAFLEKTH 158
    Length:158
    Mass (Da):18,152
    Last modified:January 23, 2007 - v3
    Checksum:i5C454D4DA82FB094
    GO
    Isoform 2 (identifier: P41498-2) [UniParc]FASTAAdd to Basket

    Also known as: ACP2, B

    The sequence of this isoform differs from the canonical sequence as follows:
         41-74: RIDSAATSTYEVGNPPDYRGQNCMKKHGIHMQHI → AIDSSAVSDWNVGRPPDPRAVNCLRNHGISTAHK

    Show »
    Length:158
    Mass (Da):17,937
    Checksum:i9BA17AFBC38AC8F6
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti2 – 21A → ACA AA sequence (PubMed:1388675)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei41 – 7434RIDSA…HMQHI → AIDSSAVSDWNVGRPPDPRA VNCLRNHGISTAHK in isoform 2. 1 PublicationVSP_004705Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF171072 mRNA. Translation: AAD50990.1.
    BC062229 mRNA. Translation: AAH62229.1.
    PIRiA53874.
    RefSeqiNP_067085.1. NM_021262.2. [P41498-1]
    UniGeneiRn.108187.
    Rn.154499.
    Rn.202830.

    Genome annotation databases

    GeneIDi24161.
    KEGGirno:24161.
    UCSCiRGD:2020. rat. [P41498-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF171072 mRNA. Translation: AAD50990.1 .
    BC062229 mRNA. Translation: AAH62229.1 .
    PIRi A53874.
    RefSeqi NP_067085.1. NM_021262.2. [P41498-1 ]
    UniGenei Rn.108187.
    Rn.154499.
    Rn.202830.

    3D structure databases

    ProteinModelPortali P41498.
    SMRi P41498. Positions 2-158.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10116.ENSRNOP00000007287.

    PTM databases

    PhosphoSitei P41498.

    Proteomic databases

    PaxDbi P41498.
    PRIDEi P41498.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 24161.
    KEGGi rno:24161.
    UCSCi RGD:2020. rat. [P41498-1 ]

    Organism-specific databases

    CTDi 52.
    RGDi 2020. Acp1.

    Phylogenomic databases

    eggNOGi COG0394.
    HOGENOMi HOG000273094.
    HOVERGENi HBG007540.
    InParanoidi P41498.
    KOi K14394.
    OrthoDBi EOG7QZGCG.
    PhylomeDBi P41498.
    TreeFami TF353727.

    Miscellaneous databases

    NextBioi 602457.
    PROi P41498.

    Gene expression databases

    Genevestigatori P41498.

    Family and domain databases

    InterProi IPR023485. Ptyr_pPase_SF.
    IPR002115. Tyr_Pase_low_mol_wt_mml.
    IPR000106. Tyr_phospatase/Ars_reductase.
    IPR017867. Tyr_phospatase_low_mol_wt.
    [Graphical view ]
    PANTHERi PTHR11717. PTHR11717. 1 hit.
    Pfami PF01451. LMWPc. 1 hit.
    [Graphical view ]
    PRINTSi PR00719. LMWPTPASE.
    PR00720. MAMMALPTPASE.
    SMARTi SM00226. LMWPc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52788. SSF52788. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH SPTAN1.
      Strain: Sprague-Dawley.
      Tissue: Kidney.
    2. "Rat liver low M(r) phosphotyrosine protein phosphatase isoenzymes: purification and amino acid sequences."
      Manao G., Pazzagli L., Cirri P., Caselli A., Camici G., Cappugi G., Saeed A., Ramponi G.
      J. Protein Chem. 11:333-345(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE (ISOFORMS 1 AND 2), CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2.
      Tissue: Liver.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Pituitary.
    4. Lubec G., Afjehi-Sadat L., Diao W.
      Submitted (APR-2007) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 20-28; 42-59 AND 114-124, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: Sprague-Dawley.
      Tissue: Hippocampus and Spinal cord.

    Entry informationi

    Entry nameiPPAC_RAT
    AccessioniPrimary (citable) accession number: P41498
    Secondary accession number(s): Q9R138
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1995
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 120 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3