Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P41498 (PPAC_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 117. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Low molecular weight phosphotyrosine protein phosphatase

Short name=LMW-PTP
Short name=LMW-PTPase
EC=3.1.3.48
Alternative name(s):
Low molecular weight cytosolic acid phosphatase
EC=3.1.3.2
Gene names
Name:Acp1
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length158 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates.

Catalytic activity

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

A phosphate monoester + H2O = an alcohol + phosphate.

Subunit structure

Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1 By similarity. Isoform 1 interacts with the SH3 domain of SPTAN1. Ref.1

Subcellular location

Cytoplasm.

Sequence similarities

Belongs to the low molecular weight phosphotyrosine protein phosphatase family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P41498-1)

Also known as: ACP1; A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P41498-2)

Also known as: ACP2; B;

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: RIDSAATSTYEVGNPPDYRGQNCMKKHGIHMQHI → AIDSSAVSDWNVGRPPDPRAVNCLRNHGISTAHK

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed
Chain2 – 158157Low molecular weight phosphotyrosine protein phosphatase
PRO_0000046561

Sites

Active site131Nucleophile By similarity
Active site191 By similarity
Active site1301Proton donor By similarity

Amino acid modifications

Modified residue21N-acetylalanine
Modified residue1321Phosphotyrosine By similarity
Modified residue1331Phosphotyrosine By similarity

Natural variations

Alternative sequence41 – 7434RIDSA…HMQHI → AIDSSAVSDWNVGRPPDPRA VNCLRNHGISTAHK in isoform 2.
VSP_004705

Experimental info

Sequence conflict21A → ACA AA sequence Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (ACP1) (A) [UniParc].

Last modified January 23, 2007. Version 3.
Checksum: 5C454D4DA82FB094

FASTA15818,152
        10         20         30         40         50         60 
MAEVGSKSVL FVCLGNICRS PIAEAVFRKL VTDENVSDNW RIDSAATSTY EVGNPPDYRG 

        70         80         90        100        110        120 
QNCMKKHGIH MQHIARQITR EDFATFDYIL CMDESNLRDL NRKSNQVKNC KAKIELLGSY 

       130        140        150 
DPQKQLIIED PYYGNDSDFE VVYQQCLRCC KAFLEKTH 

« Hide

Isoform 2 (ACP2) (B) [UniParc].

Checksum: 9BA17AFBC38AC8F6
Show »

FASTA15817,937

References

« Hide 'large scale' references
[1]"Tyrosine phosphorylation regulates alpha II spectrin cleavage by calpain."
Nicolas G., Fournier C.M., Galand C., Malbert-Colas L., Bournier O., Kroviarski Y., Bourgeois M., Camonis J.H., Dhermy D., Grandchamp B., Lecomte M.-C.
Mol. Cell. Biol. 22:3527-3536(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH SPTAN1.
Strain: Sprague-Dawley.
Tissue: Kidney.
[2]"Rat liver low M(r) phosphotyrosine protein phosphatase isoenzymes: purification and amino acid sequences."
Manao G., Pazzagli L., Cirri P., Caselli A., Camici G., Cappugi G., Saeed A., Ramponi G.
J. Protein Chem. 11:333-345(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE (ISOFORMS 1 AND 2).
Tissue: Liver.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Pituitary.
[4]Lubec G., Afjehi-Sadat L., Diao W.
Submitted (APR-2007) to UniProtKB
Cited for: PROTEIN SEQUENCE OF 20-28; 42-59 AND 114-124, IDENTIFICATION BY MASS SPECTROMETRY.
Strain: Sprague-Dawley.
Tissue: Hippocampus and Spinal cord.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF171072 mRNA. Translation: AAD50990.1.
BC062229 mRNA. Translation: AAH62229.1.
PIRA53874.
RefSeqNP_067085.1. NM_021262.2.
UniGeneRn.108187.
Rn.154499.
Rn.202830.

3D structure databases

ProteinModelPortalP41498.
SMRP41498. Positions 2-158.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING10116.ENSRNOP00000007287.

PTM databases

PhosphoSiteP41498.

Proteomic databases

PaxDbP41498.
PRIDEP41498.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID24161.
KEGGrno:24161.
UCSCRGD:2020. rat. [P41498-1]

Organism-specific databases

CTD52.
RGD2020. Acp1.

Phylogenomic databases

eggNOGCOG0394.
HOGENOMHOG000273094.
HOVERGENHBG007540.
InParanoidP41498.
KOK14394.
OrthoDBEOG7QZGCG.
PhylomeDBP41498.
TreeFamTF353727.

Gene expression databases

GenevestigatorP41498.

Family and domain databases

InterProIPR023485. Ptyr_pPase_SF.
IPR002115. Tyr_Pase_low_mol_wt_mml.
IPR000106. Tyr_phospatase/Ars_reductase.
IPR017867. Tyr_phospatase_low_mol_wt.
[Graphical view]
PANTHERPTHR11717. PTHR11717. 1 hit.
PfamPF01451. LMWPc. 1 hit.
[Graphical view]
PRINTSPR00719. LMWPTPASE.
PR00720. MAMMALPTPASE.
SMARTSM00226. LMWPc. 1 hit.
[Graphical view]
SUPFAMSSF52788. SSF52788. 1 hit.
ProtoNetSearch...

Other

NextBio602457.
PROP41498.

Entry information

Entry namePPAC_RAT
AccessionPrimary (citable) accession number: P41498
Secondary accession number(s): Q9R138
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: January 23, 2007
Last modified: April 16, 2014
This is version 117 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families