P41498 (PPAC_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Low molecular weight phosphotyrosine protein phosphatase Short name=LMW-PTP Short name=LMW-PTPase EC=3.1.3.48 | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 158 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. A phosphate monoester + H2O = an alcohol + phosphate. |
| Subunit structure | Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1 By similarity. Isoform 1 interacts with the SH3 domain of SPTAN1. Ref.1 |
| Subcellular location | |
| Sequence similarities | Belongs to the low molecular weight phosphotyrosine protein phosphatase family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P41498-1) Also known as: ACP1; A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P41498-2) Also known as: ACP2; B; The sequence of this isoform differs from the canonical sequence as follows: 41-74: RIDSAATSTYEVGNPPDYRGQNCMKKHGIHMQHI → AIDSSAVSDWNVGRPPDPRAVNCLRNHGISTAHK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||
| Chain | 2 – 158 | 157 | Low molecular weight phosphotyrosine protein phosphatase | PRO_0000046561 | |||||
Sites | |||||||||
| Active site | 13 | 1 | Nucleophile By similarity | ||||||
| Active site | 19 | 1 | By similarity | ||||||
| Active site | 130 | 1 | Proton donor By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine | ||||||
| Modified residue | 132 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 133 | 1 | Phosphotyrosine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 41 – 74 | 34 | RIDSA…HMQHI → AIDSSAVSDWNVGRPPDPRA VNCLRNHGISTAHK in isoform 2. | VSP_004705 | |||||
Experimental info | |||||||||
| Sequence conflict | 2 | 1 | A → ACA AA sequence Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Tyrosine phosphorylation regulates alpha II spectrin cleavage by calpain." Nicolas G., Fournier C.M., Galand C., Malbert-Colas L., Bournier O., Kroviarski Y., Bourgeois M., Camonis J.H., Dhermy D., Grandchamp B., Lecomte M.-C. Mol. Cell. Biol. 22:3527-3536(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH SPTAN1. Strain: Sprague-Dawley. Tissue: Kidney. |
| [2] | "Rat liver low M(r) phosphotyrosine protein phosphatase isoenzymes: purification and amino acid sequences." Manao G., Pazzagli L., Cirri P., Caselli A., Camici G., Cappugi G., Saeed A., Ramponi G. J. Protein Chem. 11:333-345(1992) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE (ISOFORMS 1 AND 2). Tissue: Liver. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pituitary. |
| [4] | Lubec G., Afjehi-Sadat L., Diao W. Submitted (APR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 20-28; 42-59 AND 114-124, MASS SPECTROMETRY. Strain: Sprague-Dawley. Tissue: Hippocampus and Spinal cord. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF171072 mRNA. Translation: AAD50990.1. BC062229 mRNA. Translation: AAH62229.1. |
| IPI | IPI00206664. IPI00231705. |
| PIR | A53874. |
| RefSeq | NP_067085.1. NM_021262.2. |
| UniGene | Rn.108187. Rn.202830. Rn.220315. |
3D structure databases | |
| ProteinModelPortal | P41498. |
| SMR | P41498. Positions 2-158. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10116.ENSRNOP00000007287. |
PTM databases | |
| PhosphoSite | P41498. |
Proteomic databases | |
| PaxDb | P41498. |
| PRIDE | P41498. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 24161. |
| KEGG | rno:24161. |
| UCSC | RGD:2020. rat. |
Organism-specific databases | |
| CTD | 52. |
| RGD | 2020. Acp1. |
Phylogenomic databases | |
| eggNOG | COG0394. |
| HOGENOM | HOG000273094. |
| HOVERGEN | HBG007540. |
| InParanoid | P41498. |
| KO | K14394. |
| OMA | YEIGSPP. |
| OrthoDB | EOG4DR9DN. |
Gene expression databases | |
| Genevestigator | P41498. |
| GermOnline | ENSRNOG00000005260. Rattus norvegicus. |
Family and domain databases | |
| InterPro | IPR023485. Ptyr_pPase_SF. IPR002115. Tyr_Pase_low_mol_wt_mml. IPR000106. Tyr_phospatase/Ars_reductase. IPR017867. Tyr_phospatase_low_mol_wt. [Graphical view] |
| PANTHER | PTHR11717. PTHR11717. 1 hit. |
| Pfam | PF01451. LMWPc. 1 hit. [Graphical view] |
| PRINTS | PR00719. LMWPTPASE. PR00720. MAMMALPTPASE. |
| SMART | SM00226. LMWPc. 1 hit. [Graphical view] |
| SUPFAM | SSF52788. Tyr_Pase_low_mol_wt. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 602457. |
Entry information
| Entry name | PPAC_RAT | ||||||||
| Accession | Primary (citable) accession number: P41498 Secondary accession number(s): Q9R138 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
