Reviewed,
UniProtKB/Swiss-Prot P41498 (PPAC_RAT)
Last modified
November 3, 2009.
Version 82.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Low molecular weight phosphotyrosine protein phosphatase Short name=LMW-PTPase Short name=LMW-PTP EC=3.1.3.48 Alternative name(s): Low molecular weight cytosolic acid phosphatase EC=3.1.3.2 | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 158 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. A phosphate monoester + H2O = an alcohol + phosphate. |
| Subunit structure | |
| Subcellular location | |
| Sequence similarities | Belongs to the low molecular weight phosphotyrosine protein phosphatase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase Protein phosphatase |
| PTM | Acetylation Phosphoprotein |
| Technical term | Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | protein amino acid dephosphorylation Inferred from electronic annotation. Source: InterPro synaptic transmissionInferred from expression pattern. Source: RGD |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell synaptosomeInferred from direct assay. Source: RGD |
| Molecular function | SH3 domain binding Ref.1 Inferred from direct assay. Source: RGD acid phosphatase activityInferred from direct assay. Source: RGD non-membrane spanning protein tyrosine phosphatase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P41498-1) Also known as: ACP1; A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P41498-2) Also known as: ACP2; B; The sequence of this isoform differs from the canonical sequence as follows: 41-74: RIDSAATSTYEVGNPPDYRGQNCMKKHGIHMQHI → AIDSSAVSDWNVGRPPDPRAVNCLRNHGISTAHK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||
| Chain | 2 – 158 | 157 | Low molecular weight phosphotyrosine protein phosphatase | PRO_0000046561 | |||||
Sites | |||||||||
| Active site | 13 | 1 | Nucleophile By similarity | ||||||
| Active site | 19 | 1 | By similarity | ||||||
| Active site | 130 | 1 | Proton donor By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine | ||||||
| Modified residue | 132 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 133 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 156 | 1 | N6-acetyllysine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 41 – 74 | 34 | RIDSA…HMQHI → AIDSSAVSDWNVGRPPDPRA VNCLRNHGISTAHK in isoform 2. | VSP_004705 | |||||
Experimental info | |||||||||
| Sequence conflict | 2 | 1 | A → ACA AA sequence Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Tyrosine phosphorylation regulates alpha II spectrin cleavage by calpain." Nicolas G., Fournier C.M., Galand C., Malbert-Colas L., Bournier O., Kroviarski Y., Bourgeois M., Camonis J.H., Dhermy D., Grandchamp B., Lecomte M.-C. Mol. Cell. Biol. 22:3527-3536(2002) [PubMed: 11971983] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH SPTAN1. Strain: Sprague-Dawley. Tissue: Kidney. |
| [2] | "Rat liver low M(r) phosphotyrosine protein phosphatase isoenzymes: purification and amino acid sequences." Manao G., Pazzagli L., Cirri P., Caselli A., Camici G., Cappugi G., Saeed A., Ramponi G. J. Protein Chem. 11:333-345(1992) [PubMed: 1388675] [Abstract] Cited for: PROTEIN SEQUENCE (ISOFORMS 1 AND 2). Tissue: Liver. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pituitary. |
| [4] | Lubec G., Afjehi-Sadat L., Diao W. Submitted (APR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 20-28; 42-59 AND 114-124, MASS SPECTROMETRY. Strain: Sprague-Dawley. Tissue: Hippocampus and Spinal cord. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF171072 mRNA. Translation: AAD50990.1. BC062229 mRNA. Translation: AAH62229.1. | |
| IPI | IPI00206664. IPI00231705. |
| PIR | A53874. |
| RefSeq | NP_067085.1. |
| UniGene | Rn.108187 Rn.202830 |
3D structure databases | |
| HSSP | HSSP built from PDB template 5PNT based on UniProtKB P24666. |
| SMR | P41498. Positions 2-158. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P41498. |
PTM databases | |
| PhosphoSite | P41498. |
Genome annotation databases | |
| Ensembl | ENSRNOT00000007287; ENSRNOP00000007287; ENSRNOG00000005260; Rattus norvegicus. [Genome view] |
| GeneID | 24161. |
Organism-specific databases | |
| CTD | 24161. |
| RGD | 2020. Acp1. |
Phylogenomic databases | |
| HOVERGEN | P41498. |
| OMA | CHGNICR. |
Enzyme and pathway databases | |
| BRENDA | 3.1.3.2. 248. 3.1.3.48. 248. |
Gene expression databases | |
| ArrayExpress | P41498. |
| Genevestigator | P41498. |
| GermOnline | ENSRNOG00000005260. Rattus norvegicus. |
Family and domain databases | |
| InterPro | IPR002115. Tyr_Pase_low_mol_wt_mml. IPR000106. Tyr_phospatase/Ars_reductase. IPR017867. Tyr_phospatase_low_mol_wt. [Graphical view] |
| PANTHER | PTHR11717. Low_mwt_PTPase. 1 hit. |
| Pfam | PF01451. LMWPc. 1 hit. [Graphical view] |
| PRINTS | PR00719. LMWPTPASE. PR00720. MAMMALPTPASE. |
| SMART | SM00226. LMWPc. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 602457. |
Entry information
| Entry name | PPAC_RAT | ||||||||
| Accession | Primary (citable) accession number: P41498 Secondary accession number(s): Q9R138 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||

Clusters with


