Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low molecular weight phosphotyrosine protein phosphatase

Gene

Acp1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates.

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
A phosphate monoester + H2O = an alcohol + phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei13NucleophileBy similarity1
Active sitei19By similarity1
Active sitei130Proton donorBy similarity1

GO - Molecular functioni

  • acid phosphatase activity Source: RGD
  • non-membrane spanning protein tyrosine phosphatase activity Source: InterPro
  • phosphatase activity Source: RGD
  • protein tyrosine phosphatase activity Source: RGD
  • SH3 domain binding Source: RGD

GO - Biological processi

  • chemical synaptic transmission Source: RGD

Keywordsi

Molecular functionHydrolase, Protein phosphatase

Names & Taxonomyi

Protein namesi
Recommended name:
Low molecular weight phosphotyrosine protein phosphatase (EC:3.1.3.48)
Short name:
LMW-PTP
Short name:
LMW-PTPase
Alternative name(s):
Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2)
Gene namesi
Name:Acp1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi2020. Acp1.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved1 Publication
ChainiPRO_00000465612 – 158Low molecular weight phosphotyrosine protein phosphataseAdd BLAST157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanine1 Publication1
Modified residuei132PhosphotyrosineBy similarity1
Modified residuei133PhosphotyrosineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiP41498.
PRIDEiP41498.

PTM databases

iPTMnetiP41498.
PhosphoSitePlusiP41498.

Interactioni

Subunit structurei

Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1 (By similarity). Isoform 1 interacts with the SH3 domain of SPTAN1.By similarity1 Publication

GO - Molecular functioni

  • SH3 domain binding Source: RGD

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000007287.

Structurei

3D structure databases

ProteinModelPortaliP41498.
SMRiP41498.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3217. Eukaryota.
COG0394. LUCA.
HOGENOMiHOG000273094.
HOVERGENiHBG007540.
InParanoidiP41498.
KOiK14394.
PhylomeDBiP41498.
TreeFamiTF353727.

Family and domain databases

InterProiView protein in InterPro
IPR023485. Ptyr_pPase.
IPR036196. Ptyr_pPase_sf.
IPR002115. Tyr_Pase_low_mol_wt_mml.
IPR017867. Tyr_phospatase_low_mol_wt.
PfamiView protein in Pfam
PF01451. LMWPc. 1 hit.
PRINTSiPR00719. LMWPTPASE.
PR00720. MAMMALPTPASE.
SMARTiView protein in SMART
SM00226. LMWPc. 1 hit.
SUPFAMiSSF52788. SSF52788. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P41498-1) [UniParc]FASTAAdd to basket
Also known as: ACP1, A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEVGSKSVL FVCLGNICRS PIAEAVFRKL VTDENVSDNW RIDSAATSTY
60 70 80 90 100
EVGNPPDYRG QNCMKKHGIH MQHIARQITR EDFATFDYIL CMDESNLRDL
110 120 130 140 150
NRKSNQVKNC KAKIELLGSY DPQKQLIIED PYYGNDSDFE VVYQQCLRCC

KAFLEKTH
Length:158
Mass (Da):18,152
Last modified:January 23, 2007 - v3
Checksum:i5C454D4DA82FB094
GO
Isoform 2 (identifier: P41498-2) [UniParc]FASTAAdd to basket
Also known as: ACP2, B

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: RIDSAATSTYEVGNPPDYRGQNCMKKHGIHMQHI → AIDSSAVSDWNVGRPPDPRAVNCLRNHGISTAHK

Show »
Length:158
Mass (Da):17,937
Checksum:i9BA17AFBC38AC8F6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti2A → ACA AA sequence (PubMed:1388675).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00470541 – 74RIDSA…HMQHI → AIDSSAVSDWNVGRPPDPRA VNCLRNHGISTAHK in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF171072 mRNA. Translation: AAD50990.1.
BC062229 mRNA. Translation: AAH62229.1.
PIRiA53874.
RefSeqiNP_067085.1. NM_021262.2. [P41498-1]
UniGeneiRn.108187.
Rn.154499.
Rn.202830.
Rn.220315.

Genome annotation databases

GeneIDi24161.
KEGGirno:24161.
UCSCiRGD:2020. rat. [P41498-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPPAC_RAT
AccessioniPrimary (citable) accession number: P41498
Secondary accession number(s): Q9R138
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: January 23, 2007
Last modified: November 22, 2017
This is version 142 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families