P41235 (HNF4A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 158.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Hepatocyte nuclear factor 4-alpha Short name=HNF-4-alpha Alternative name(s): Nuclear receptor subfamily 2 group A member 1 Transcription factor 14 Short name=TCF-14 Transcription factor HNF-4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 474 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcriptionally controlled transcription factor. Binds to DNA sites required for the transcription of alpha 1-antitrypsin, apolipoprotein CIII, transthyretin genes and HNF1-alpha. May be essential for development of the liver, kidney and intestine. |
| Subunit structure | Homodimerization is required for HNF4-alpha to bind to its recognition site. |
| Subcellular location | |
| Post-translational modification | Phosphorylated on tyrosine residue(s); phosphorylation is important for its DNA-binding activity. Phosphorylation may directly or indirectly play a regulatory role in the subnuclear distribution. Phosphorylation at Ser-313 by AMPK reduces the ability to form homodimers and bind DNA. Ref.10 Ref.11 Ref.12 Acetylation at Lys-458 lowers transcriptional activation by about two-fold. |
| Involvement in disease | Maturity-onset diabetes of the young 1 (MODY1) [MIM:125850]: A form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease. |
| Miscellaneous | Binds fatty acids. |
| Sequence similarities | Belongs to the nuclear hormone receptor family. NR2 subfamily. Contains 1 nuclear receptor DNA-binding domain. |
| Sequence caution | The sequence CAA54248.1 differs from that shown. Reason: Erroneous initiation. The sequence CAA61133.1 differs from that shown. Reason: Frameshift at positions 2 and 7. The sequence CAA61134.1 differs from that shown. Reason: Frameshift at positions 2 and 7. The sequence CAA61135.1 differs from that shown. Reason: Frameshift at positions 2 and 7. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform HNF4-Alpha-1 (identifier: P41235-1) Also known as: HNF-4B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform HNF4-Alpha-2 (identifier: P41235-2) Also known as: HNF4-A; The sequence of this isoform differs from the canonical sequence as follows: 418-428: CEWPRPRGQAA → S | ||||||
| Note: Produced by alternative splicing of isoform HNF4-Alpha-1. | ||||||
| Isoform HNF4-Alpha-3 (identifier: P41235-3) Also known as: HNF4-C; The sequence of this isoform differs from the canonical sequence as follows: 378-474: SPSDAPHAHH...QPTITKQEVI → PCQAQEGRGW...SPLCRFGQVA | ||||||
| Note: Produced by alternative splicing of isoform HNF4-Alpha-1. | ||||||
| Isoform HNF4-Alpha-4 (identifier: P41235-4) The sequence of this isoform differs from the canonical sequence as follows: 38-38: N → NDLLPLRLARLRHPLRHHWSISGGVDSSPQG | ||||||
| Note: Produced by alternative splicing of isoform HNF4-Alpha-1. | ||||||
| Isoform HNF4-Alpha-7 (identifier: P41235-5) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGN → MVSVNAPLGAPVESSY | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform HNF4-Alpha-8 (identifier: P41235-6) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGN → MVSVNAPLGAPVESSY 418-428: CEWPRPRGQAA → S | ||||||
| Note: Produced by alternative splicing of isoform HNF4-Alpha-7. | ||||||
| Isoform HNF4-Alpha-9 (identifier: P41235-7) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGN → MVSVNAPLGAPVESSY 378-474: SPSDAPHAHH...QPTITKQEVI → PCQAQEGRGW...SPLCRFGQVA | ||||||
| Note: Produced by alternative splicing of isoform HNF4-Alpha-7. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 474 | 474 | Hepatocyte nuclear factor 4-alpha | PRO_0000053558 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNA binding | 57 – 132 | 76 | Nuclear receptor | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 60 – 80 | 21 | NR C4-type | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 96 – 120 | 25 | NR C4-type | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 142 | 1 | Phosphoserine Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 166 | 1 | Phosphothreonine Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 167 | 1 | Phosphoserine Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 313 | 1 | Phosphoserine; by AMPK Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 429 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 432 | 1 | Phosphothreonine Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 436 | 1 | Phosphoserine Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 458 | 1 | N6-acetyllysine Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 234 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 307 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 38 | 38 | MRLSK…LTMGN → MVSVNAPLGAPVESSY in isoform HNF4-Alpha-7, isoform HNF4-Alpha-8 and isoform HNF4-Alpha-9. | VSP_026030 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 38 | 1 | N → NDLLPLRLARLRHPLRHHWS ISGGVDSSPQG in isoform HNF4-Alpha-4. | VSP_003673 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 378 – 474 | 97 | SPSDA…KQEVI → PCQAQEGRGWSGDSPGDRPH TVSSPLSSLASPLCRFGQVA in isoform HNF4-Alpha-3 and isoform HNF4-Alpha-9. | VSP_003675 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 418 – 428 | 11 | CEWPRPRGQAA → S in isoform HNF4-Alpha-2 and isoform HNF4-Alpha-8. | VSP_003674 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 136 | 1 | R → W in MODY1. Ref.14 | VAR_004668 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 139 | 1 | T → I. Ref.5 Ref.16 Corresponds to variant rs1800961 [ dbSNP | Ensembl ]. | VAR_004669 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 264 | 1 | V → M in late-onset NIDDM. Ref.16 | VAR_010600 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 285 | 1 | E → Q in MODY1. Ref.15 | VAR_010601 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 402 | 1 | V → I in MODY1; reduced transactivation activity. Ref.17 | VAR_004670 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 445 | 1 | P → S. Ref.1 Corresponds to variant rs1063239 [ dbSNP | Ensembl ]. | VAR_011785 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 453 | 1 | V → I. Ref.5 | VAR_062267 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 313 | 1 | S → A: Abolishes AMPK-mediated phosphorylation. Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 313 | 1 | S → D: Phosphomimetic mutant that leads to reduced ability to bind DNA. Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 440 | 1 | G → A in CAA54248. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 61 – 63 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 64 – 66 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 69 – 71 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 78 – 89 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 106 – 111 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 113 – 123 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 127 – 129 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 149 – 153 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 155 – 163 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 176 – 178 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 184 – 202 | 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 206 – 209 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 213 – 222 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 224 – 236 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 239 – 244 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 250 – 254 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 256 – 261 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 262 – 271 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 273 – 279 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 283 – 294 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 305 – 324 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 325 – 328 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 333 – 338 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 340 – 360 | 21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 368 – 374 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of a third isoform of human hepatocyte nuclear factor 4." Kritis A.A., Argyrokastritis A., Moschonas N.K., Power S., Katrakili N., Zannis V.I., Cereghini S., Talianidis I. Gene 173:275-280(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS HNF4-ALPHA-1; HNF4-ALPHA-2 AND HNF4-ALPHA-3), VARIANT SER-445. Tissue: Liver. |
| [2] | "Human hepatocyte nuclear factor 4 isoforms are encoded by distinct and differentially expressed genes." Drewes T., Senkel S., Holewa B., Ryffel G.U. Mol. Cell. Biol. 16:925-931(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. Tissue: Kidney. |
| [3] | "Mutations in the hepatocyte nuclear factor-4alpha gene in maturity-onset diabetes of the young (MODY1)." Yamagata K., Furuta H., Oda N., Kaisaki P.J., Menzel S., Cox N.J., Fajans S.S., Signorini S., Stoffel M., Bell G.I. Nature 384:458-460(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Variation in P1 and P2 promoter-driven hepatocyte nuclear factor-4a (HNF4a) expression in human tissues: implications for carcinogenesis." Tanaka T., Jiang S., Hotta H., Takano K., Iwanari H., Hirayama Y., Midorikawa Y., Hippo Y., Watanabe A., Yamashita H., Kumakura J., Uchiyama Y., Hasegawa G., Aburatani H., Hamakubo T., Naito M., Sakai J., Kodama T. Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE PROMOTER USAGE (ISOFORMS HNF4-ALPHA-7; HNF4-ALPHA-8 AND HNF4-ALPHA-9). |
| [5] | SeattleSNPs variation discovery resource Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ILE-139 AND ILE-453. |
| [6] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM HNF4-ALPHA-3). |
| [9] | "Cloning and sequencing of cDNAs encoding the human hepatocyte nuclear factor 4 indicate the presence of two isoforms in human liver." Chartier F.L., Bossu J.-P., Laudet V., Fruchart J.-C., Laine B. Gene 147:269-272(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 4-474, ALTERNATIVE SPLICING. Tissue: Liver. |
| [10] | "Recruitment of hepatocyte nuclear factor 4 into specific intranuclear compartments depends on tyrosine phosphorylation that affects its DNA-binding and transactivation potential." Ktistaki E., Ktistakis N.T., Papadogeorgaki E., Talianidis I. Proc. Natl. Acad. Sci. U.S.A. 92:9876-9880(1995) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION. |
| [11] | "AMP-activated protein kinase regulates HNF4alpha transcriptional activity by inhibiting dimer formation and decreasing protein stability." Hong Y.H., Varanasi U.S., Yang W., Leff T. J. Biol. Chem. 278:27495-27501(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-313, MUTAGENESIS OF SER-313. |
| [12] | "Multiple post-translational modifications in hepatocyte nuclear factor 4alpha." Yokoyama A., Katsura S., Ito R., Hashiba W., Sekine H., Fujiki R., Kato S. Biochem. Biophys. Res. Commun. 410:749-753(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-142; THR-166; SER-167; THR-432 AND SER-436, UBIQUITINATION AT LYS-234 AND LYS-307, ACETYLATION AT LYS-458. |
| [13] | "Structural basis for HNF-4alpha activation by ligand and coactivator binding." Duda K., Chi Y.-I., Shoelson S.E. J. Biol. Chem. 279:23311-23316(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 142-378, FATTY ACID BINDING. |
| [14] | "Organization and partial sequence of the hepatocyte nuclear factor-4-alpha/MODY1 gene and identification of a missense mutation, R127W, in a Japanese family with MODY." Furuta H., Iwasaki N., Oda N., Hinokio Y., Horikawa Y., Yamagata K., Yano N., Sugahiro J., Ogata M., Ohgawara H., Omori Y., Iwamoto Y., Bell G.I. Diabetes 46:1652-1657(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT MODY1 TRP-136. |
| [15] | "A missense mutation in the hepatocyte nuclear factor 4 alpha gene in a UK pedigree with maturity-onset diabetes of the young." Bulman M.P., Dronsfield M.J., Frayling T.M., Appleton M., Bain S.C., Ellard S., Hattersley A.T. Diabetologia 40:859-862(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT MODY1 GLN-285. |
| [16] | "Studies of the genetic variability of the coding region of the hepatocyte nuclear factor-4alpha in Caucasians with maturity onset NIDDM." Moeller A.M., Urhammer S.A., Dalgaard L.T., Reneland R., Berglund L., Hansen T., Clausen J.O., Lithell H., Pedersen O. Diabetologia 40:980-983(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT NIDDM MET-264, VARIANT ILE-139. |
| [17] | "A missense mutation in hepatocyte nuclear factor-4-alpha, resulting in a reduced transactivation activity, in human late-onset non-insulin-dependent diabetes mellitus." Hani E.H., Suaud L., Boutin P., Chevre J.-C., Durand E., Philippi A., Demenais F., Vionnet N., Furuta H., Velho G., Bell G.I., Laine B., Froguel P. J. Clin. Invest. 101:521-526(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT MODY1 ILE-402. |
| + | Additional computationally mapped references. |
Web resources
| GeneReviews |
| Wikipedia Hepatocyte nuclear factors entry |
| SeattleSNPs |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X87870 mRNA. Translation: CAA61133.1. Frameshift. X87871 mRNA. Translation: CAA61134.1. Frameshift. X87872 mRNA. Translation: CAA61135.1. Frameshift. Z49825 mRNA. Translation: CAA89989.1. AY680696 mRNA. Translation: AAT91237.1. AY680697 mRNA. Translation: AAT91238.1. AY680698 mRNA. Translation: AAT91239.1. U72969 U72968 Genomic DNA. Translation: AAB48082.1. Sequence problems.U72967 U72966 Genomic DNA. Translation: AAB48083.1.EF591040 Genomic DNA. Translation: ABQ52204.1. AL132772 Genomic DNA. Translation: CAC01303.1. AL132772 Genomic DNA. Translation: CAI18856.1. CH471077 Genomic DNA. Translation: EAW75924.1. CH471077 Genomic DNA. Translation: EAW75925.1. BC137539 mRNA. Translation: AAI37540.1. BC137540 mRNA. Translation: AAI37541.1. X76930 mRNA. Translation: CAA54248.1. Different initiation. | ||||||||||||||||||||||||
| IPI | IPI00013196. IPI00216080. IPI00300558. IPI00412368. IPI00641248. IPI00645235. IPI00847265. | ||||||||||||||||||||||||
| PIR | JC4937. JC4938. JC6096. | ||||||||||||||||||||||||
| RefSeq | NP_000448.3. NM_000457.4. NP_001025174.1. NM_001030003.2. NP_001025175.1. NM_001030004.2. NP_001245284.1. NM_001258355.1. NP_787110.2. NM_175914.4. NP_849181.1. NM_178850.2. | ||||||||||||||||||||||||
| UniGene | Hs.116462. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | P41235. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-499N. | ||||||||||||||||||||||||
| IntAct | P41235. 1 interaction. | ||||||||||||||||||||||||
| MINT | MINT-269829. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | P41235. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 148886624. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | P41235. | ||||||||||||||||||||||||
| PRIDE | P41235. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000316099; ENSP00000312987; ENSG00000101076. ENST00000316673; ENSP00000315180; ENSG00000101076. ENST00000415691; ENSP00000412111; ENSG00000101076. ENST00000443598; ENSP00000410911; ENSG00000101076. ENST00000457232; ENSP00000396216; ENSG00000101076. | ||||||||||||||||||||||||
| GeneID | 3172. | ||||||||||||||||||||||||
| KEGG | hsa:3172. | ||||||||||||||||||||||||
| UCSC | uc002xlt.3. human. uc002xlu.3. human. uc002xly.3. human. uc002xma.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 3172. | ||||||||||||||||||||||||
| GeneCards | GC20P042984. | ||||||||||||||||||||||||
| HGNC | HGNC:5024. HNF4A. | ||||||||||||||||||||||||
| HPA | CAB019417. HPA004712. | ||||||||||||||||||||||||
| MIM | 125850. phenotype. 600281. gene. 606391. phenotype. | ||||||||||||||||||||||||
| neXtProt | NX_P41235. | ||||||||||||||||||||||||
| Orphanet | 263455. Hyperinsulinism due to HNF4A deficiency. 552. MODY syndrome. | ||||||||||||||||||||||||
| PharmGKB | PA29349. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG241134. | ||||||||||||||||||||||||
| HOVERGEN | HBG005606. | ||||||||||||||||||||||||
| KO | K07292. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Pathway_Interaction_DB | hnf3bpathway. FOXA2 and FOXA3 transcription factor networks. hif1_tfpathway. HIF-1-alpha transcription factor network. smad2_3nuclearpathway. Regulation of nuclear SMAD2/3 signaling. | ||||||||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. REACT_71. Gene Expression. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | P41235. | ||||||||||||||||||||||||
| Bgee | P41235. | ||||||||||||||||||||||||
| Genevestigator | P41235. | ||||||||||||||||||||||||
| GermOnline | ENSG00000101076. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 1.10.565.10. 1 hit. 3.30.50.10. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR003068. COUP_TF. IPR008946. Nucl_hormone_rcpt_ligand-bd. IPR000536. Nucl_hrmn_rcpt_lig-bd_core. IPR001723. Str_hrmn_rcpt. IPR001628. Znf_hrmn_rcpt. IPR013088. Znf_NHR/GATA. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00104. Hormone_recep. 1 hit. PF00105. zf-C4. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PRINTS | PR01282. COUPTNFACTOR. PR00398. STRDHORMONER. PR00047. STROIDFINGER. | ||||||||||||||||||||||||
| SMART | SM00430. HOLI. 1 hit. SM00399. ZnF_C4. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF48508. Str_ncl_receptor. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS00031. NUCLEAR_REC_DBD_1. 1 hit. PS51030. NUCLEAR_REC_DBD_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| BindingDB | P41235. | ||||||||||||||||||||||||
| ChEMBL | CHEMBL5398. | ||||||||||||||||||||||||
| EvolutionaryTrace | P41235. | ||||||||||||||||||||||||
| GenomeRNAi | 3172. | ||||||||||||||||||||||||
| NextBio | 12578. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | HNF4A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P41235 Secondary accession number(s): A5JW41 Q9NQH0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
