Reviewed,
UniProtKB/Swiss-Prot P41235 (HNF4A_HUMAN)
Last modified
July 7, 2009.
Version 115.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Hepatocyte nuclear factor 4-alpha Short name=HNF-4-alpha Alternative name(s): Transcription factor HNF-4 Nuclear receptor subfamily 2 group A member 1 Transcription factor 14 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 474 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Transcriptionally controlled transcription factor. Binds to DNA sites required for the transcription of alpha 1-antitrypsin, apolipoprotein CIII, transthyretin genes and HNF1-alpha. May be essential for development of the liver, kidney and intestine. |
| Subunit structure | Homodimerization is required for HNF4-alpha to bind to its recognition site. |
| Subcellular location | |
| Post-translational modification | Phosphorylated on tyrosine residue(s); phosphorylation is important for its DNA-binding activity. Phosphorylation may directly or indirectly play a regulatory role in the subnuclear distribution. Ref.7 |
| Involvement in disease | Defects in HNF4A are the cause of maturity onset diabetes of the young type 1 (MODY1) [MIM:125850]; also shortened MODY-1. MODY [MIM:606391] is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age) and a primary defect in insulin secretion. The clinical phenotype of MODY1 is characterized by severe insulin secretory defects, and by major hyperglycemia associated with microvascular complications. Ref.9 Ref.10 Ref.12 |
| Miscellaneous | Binds fatty acids. |
| Sequence similarities | Belongs to the nuclear hormone receptor family. NR2 subfamily. Contains 1 nuclear receptor DNA-binding domain. |
| Sequence caution | The sequence CAA61133.1 differs from that shown. Reason: Frameshift at positions 2 and 7. The sequence CAA61134.1 differs from that shown. Reason: Frameshift at positions 2 and 7. The sequence CAA61135.1 differs from that shown. Reason: Frameshift at positions 2 and 7. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| EXT2 | Q93063 | 1 | EBI-1049011,EBI-1047761 | |
| PABPC4 | Q13310 | 1 | EBI-1049011,EBI-372844 | |
| RAD50 | Q92878 | 1 | EBI-1049011,EBI-495494 | |
| SNCG | O76070 | 1 | EBI-1049011,EBI-1053810 | |
| STK16 | O75716 | 1 | EBI-1049011,EBI-1046308 |
Alternative products
| This entry describes 7 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform HNF4-Alpha-1 (identifier: P41235-1) Also known as: HNF-4B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform HNF4-Alpha-2 (identifier: P41235-2) Also known as: HNF4-A; The sequence of this isoform differs from the canonical sequence as follows: 418-428: CEWPRPRGQAA → S | ||||||
| Note: Produced by alternative splicing of isoform HNF4-Alpha-1. | ||||||
| Isoform HNF4-Alpha-3 (identifier: P41235-3) Also known as: HNF4-C; The sequence of this isoform differs from the canonical sequence as follows: 378-474: SPSDAPHAHH...QPTITKQEVI → PCQAQEGRGW...SPLCRFGQVA | ||||||
| Note: Produced by alternative splicing of isoform HNF4-Alpha-1. | ||||||
| Isoform HNF4-Alpha-4 (identifier: P41235-4) The sequence of this isoform differs from the canonical sequence as follows: 38-38: N → NDLLPLRLARLRHPLRHHWSISGGVDSSPQG | ||||||
| Note: Produced by alternative splicing of isoform HNF4-Alpha-1. | ||||||
| Isoform HNF4-Alpha-7 (identifier: P41235-5) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGN → MVSVNAPLGAPVESSY | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform HNF4-Alpha-8 (identifier: P41235-6) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGN → MVSVNAPLGAPVESSY 418-428: CEWPRPRGQAA → S | ||||||
| Note: Produced by alternative splicing of isoform HNF4-Alpha-7. | ||||||
| Isoform HNF4-Alpha-9 (identifier: P41235-7) The sequence of this isoform differs from the canonical sequence as follows: 1-38: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGN → MVSVNAPLGAPVESSY 378-474: SPSDAPHAHH...QPTITKQEVI → PCQAQEGRGW...SPLCRFGQVA | ||||||
| Note: Produced by alternative splicing of isoform HNF4-Alpha-7. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 474 | 474 | Hepatocyte nuclear factor 4-alpha | PRO_0000053558 | |||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||
| DNA binding | 57 – 132 | 76 | Nuclear receptor | ||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 60 – 80 | 21 | NR C4-type | ||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 96 – 120 | 25 | NR C4-type | ||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 429 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||||||||
| Modified residue | 432 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 38 | 38 | MRLSK…LTMGN → MVSVNAPLGAPVESSY in isoform HNF4-Alpha-7, isoform HNF4-Alpha-8 and isoform HNF4-Alpha-9. | VSP_026030 | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 38 | 1 | N → NDLLPLRLARLRHPLRHHWS ISGGVDSSPQG in isoform HNF4-Alpha-4. | VSP_003673 | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 378 – 474 | 97 | SPSDA…KQEVI → PCQAQEGRGWSGDSPGDRPH TVSSPLSSLASPLCRFGQVA in isoform HNF4-Alpha-3 and isoform HNF4-Alpha-9. | VSP_003675 | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 418 – 428 | 11 | CEWPRPRGQAA → S in isoform HNF4-Alpha-2 and isoform HNF4-Alpha-8. | VSP_003674 | |||||||||||||||||||||||||||||||||||||||
| Natural variant | 136 | 1 | R → W in MODY1. Ref.9 | VAR_004668 | |||||||||||||||||||||||||||||||||||||||
| Natural variant | 139 | 1 | T → I: dbSNP rs1800961. Ref.11 | VAR_004669 | |||||||||||||||||||||||||||||||||||||||
| Natural variant | 264 | 1 | V → M in late-onset NIDDM. Ref.11 | VAR_010600 | |||||||||||||||||||||||||||||||||||||||
| Natural variant | 285 | 1 | E → Q in MODY1. Ref.10 | VAR_010601 | |||||||||||||||||||||||||||||||||||||||
| Natural variant | 402 | 1 | V → I in MODY1; reduced transactivation activity. Ref.12 | VAR_004670 | |||||||||||||||||||||||||||||||||||||||
| Natural variant | 445 | 1 | P → S: dbSNP rs1063239. Ref.1 | VAR_011785 | |||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 440 | 1 | G → A in CAA54248. Ref.6 | ||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 149 – 153 | 5 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 155 – 163 | 9 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 176 – 178 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 184 – 202 | 19 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 206 – 209 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 213 – 222 | 10 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 224 – 236 | 13 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 239 – 244 | 6 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 250 – 254 | 5 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 256 – 261 | 6 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 262 – 271 | 10 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 273 – 279 | 7 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 283 – 294 | 12 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 305 – 324 | 20 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 325 – 328 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 333 – 338 | 6 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 340 – 360 | 21 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 368 – 374 | 7 | |||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of a third isoform of human hepatocyte nuclear factor 4." Kritis A.A., Argyrokastritis A., Moschonas N.K., Power S., Katrakili N., Zannis V.I., Cereghini S., Talianidis I. Gene 173:275-280(1996) [PubMed: 8964514] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS HNF4-ALPHA-1; HNF4-ALPHA-2 AND HNF4-ALPHA-3), VARIANT SER-445. Tissue: Liver. |
| [2] | "Human hepatocyte nuclear factor 4 isoforms are encoded by distinct and differentially expressed genes." Drewes T., Senkel S., Holewa B., Ryffel G.U. Mol. Cell. Biol. 16:925-931(1996) [PubMed: 8622695] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. Tissue: Kidney. |
| [3] | "Mutations in the hepatocyte nuclear factor-4alpha gene in maturity-onset diabetes of the young (MODY1)." Yamagata K., Furuta H., Oda N., Kaisaki P.J., Menzel S., Cox N.J., Fajans S.S., Signorini S., Stoffel M., Bell G.I. Nature 384:458-460(1996) [PubMed: 8945471] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Variation in P1 and P2 promoter-driven hepatocyte nuclear factor-4a (HNF4a) expression in human tissues: implications for carcinogenesis." Tanaka T., Jiang S., Hotta H., Takano K., Iwanari H., Hirayama Y., Midorikawa Y., Hippo Y., Watanabe A., Yamashita H., Kumakura J., Uchiyama Y., Hasegawa G., Aburatani H., Hamakubo T., Naito M., Sakai J., Kodama T. Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE PROMOTER USAGE (ISOFORMS HNF4-ALPHA-7; HNF4-ALPHA-8 AND HNF4-ALPHA-9). |
| [5] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "Cloning and sequencing of cDNAs encoding the human hepatocyte nuclear factor 4 indicate the presence of two isoforms in human liver." Chartier F.L., Bossu J.-P., Laudet V., Fruchart J.-C., Laine B. Gene 147:269-272(1994) [PubMed: 7926813] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 4-474, ALTERNATIVE SPLICING. Tissue: Liver. |
| [7] | "Recruitment of hepatocyte nuclear factor 4 into specific intranuclear compartments depends on tyrosine phosphorylation that affects its DNA-binding and transactivation potential." Ktistaki E., Ktistakis N.T., Papadogeorgaki E., Talianidis I. Proc. Natl. Acad. Sci. U.S.A. 92:9876-9880(1995) [PubMed: 7568236] [Abstract] Cited for: PHOSPHORYLATION. |
| [8] | "Structural basis for HNF-4alpha activation by ligand and coactivator binding." Duda K., Chi Y.-I., Shoelson S.E. J. Biol. Chem. 279:23311-23316(2004) [PubMed: 14982928] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 142-378, FATTY ACID BINDING. |
| [9] | "Organization and partial sequence of the hepatocyte nuclear factor-4-alpha/MODY1 gene and identification of a missense mutation, R127W, in a Japanese family with MODY." Furuta H., Iwasaki N., Oda N., Hinokio Y., Horikawa Y., Yamagata K., Yano N., Sugahiro J., Ogata M., Ohgawara H., Omori Y., Iwamoto Y., Bell G.I. Diabetes 46:1652-1657(1997) [PubMed: 9313765] [Abstract] Cited for: VARIANT MODY1 TRP-136. |
| [10] | "A missense mutation in the hepatocyte nuclear factor 4 alpha gene in a UK pedigree with maturity-onset diabetes of the young." Bulman M.P., Dronsfield M.J., Frayling T.M., Appleton M., Bain S.C., Ellard S., Hattersley A.T. Diabetologia 40:859-862(1997) [PubMed: 9243109] [Abstract] Cited for: VARIANT MODY1 GLN-285. |
| [11] | "Studies of the genetic variability of the coding region of the hepatocyte nuclear factor-4alpha in Caucasians with maturity onset NIDDM." Moeller A.M., Urhammer S.A., Dalgaard L.T., Reneland R., Berglund L., Hansen T., Clausen J.O., Lithell H., Pedersen O. Diabetologia 40:980-983(1997) [PubMed: 9267996] [Abstract] Cited for: VARIANT NIDDM MET-264, VARIANT ILE-139. |
| [12] | "A missense mutation in hepatocyte nuclear factor-4-alpha, resulting in a reduced transactivation activity, in human late-onset non-insulin-dependent diabetes mellitus." Hani E.H., Suaud L., Boutin P., Chevre J.-C., Durand E., Philippi A., Demenais F., Vionnet N., Furuta H., Velho G., Bell G.I., Laine B., Froguel P. J. Clin. Invest. 101:521-526(1998) [PubMed: 9449683] [Abstract] Cited for: VARIANT MODY1 ILE-402. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| X87870 mRNA. Translation: CAA61133.1. Frameshift. X87871 mRNA. Translation: CAA61134.1. Frameshift. X87872 mRNA. Translation: CAA61135.1. Frameshift. Z49825 mRNA. Translation: CAA89989.1. AY680696 mRNA. Translation: AAT91237.1. AY680697 mRNA. Translation: AAT91238.1. AY680698 mRNA. Translation: AAT91239.1. U72969 U72968 Genomic DNA. Translation: AAB48082.1. Sequence problems.U72967 U72966 Genomic DNA. Translation: AAB48083.1. AL132772 Genomic DNA. Translation: CAC01303.1. AL132772 Genomic DNA. Translation: CAI18856.1. X76930 mRNA. Translation: CAA54248.1. Different initiation. | |||||||||||||||||||
| IPI | IPI00013196. IPI00216080. IPI00300558. IPI00412368. IPI00641248. IPI00645235. IPI00847265. | ||||||||||||||||||
| PIR | JC4937. JC4938. JC6096. | ||||||||||||||||||
| RefSeq | NP_000448.3. NP_001025174.1. NP_001025175.1. NP_787110.2. NP_849180.1. NP_849181.1. | ||||||||||||||||||
| UniGene | Hs.116462 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| SMR | P41235. Positions 138-369. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP:499N. | ||||||||||||||||||
| IntAct | P41235. 5 interactions. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P41235. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | P41235. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSG00000101076. Homo sapiens. [Contig view] | ||||||||||||||||||
| GeneID | 3172. | ||||||||||||||||||
| KEGG | hsa:3172. | ||||||||||||||||||
| UCSC | uc002xlt.1. human. uc002xlu.1. human. uc002xlv.1. human. uc002xly.1. human. uc002xlz.1. human. uc002xma.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| GeneCards | GC20P042463. | ||||||||||||||||||
| H-InvDB | HIX0015837. HIX0040507. | ||||||||||||||||||
| HGNC | HGNC:5024. HNF4A. | ||||||||||||||||||
| HPA | CAB001387. HPA004712. | ||||||||||||||||||
| MIM | 125850. phenotype. 600281. gene. 606391. phenotype. | ||||||||||||||||||
| Orphanet | 552. MODY syndrome. 98800. MODY1. | ||||||||||||||||||
| PharmGKB | PA29349. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOVERGEN | P41235. | ||||||||||||||||||
| OMA | P41235. KIKRMRY. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Pathway_Interaction_DB | hnf3bpathway. FOXA2 and FOXA3 transcription factor networks. hif1_tfpathway. HIF-1-alpha transcription factor network. smad2_3nuclearpathway. Regulation of nuclear SMAD2/3 signaling. | ||||||||||||||||||
| Reactome | REACT_13698. Regulation of beta-cell development. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P41235. | ||||||||||||||||||
| Bgee | P41235. | ||||||||||||||||||
| GermOnline | ENSG00000101076. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR008946. Nucl_hormone_rcpt_ligand-bd. IPR000536. Nucl_hrmn_rcpt_lig-bd_core. IPR000003. RtnoidX_rcpt. IPR001723. Str_hrmn_rcpt. IPR001628. Znf_hrmn_rcpt. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:1.10.565.10. Nucl_hrmn_rcpt_lig_bd. 1 hit. | ||||||||||||||||||
| Pfam | PF00104. Hormone_recep. 1 hit. PF00105. zf-C4. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00545. RETINOIDXR. PR00398. STRDHORMONER. PR00047. STROIDFINGER. | ||||||||||||||||||
| ProDom | PD000035. Znf_C4steroid. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||
| SMART | SM00430. HOLI. 1 hit. SM00399. ZnF_C4. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00031. NUCLEAR_REC_DBD_1. 1 hit. PS51030. NUCLEAR_REC_DBD_2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 12578. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | HNF4A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P41235 Secondary accession number(s): O00659 Q9NQH0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


