P41231 B2R9W3 Q96EM8 P2RY2_HUMAN P2Y purinoceptor 2 P2Y2 P2U purinoceptor 1 P2U1 ATP receptor Purinergic receptor P2RY2 P2RU1 Homo sapiens Human Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Cloning and expression of a human P2U nucleotide receptor, a target for cystic fibrosis pharmacotherapy. NUCLEOTIDE SEQUENCE [MRNA] Airway epithelium Cloning and expression of a human P2U nucleotide receptor, a target for cystic fibrosis pharmacotherapy. SEQUENCE REVISION cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org). NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] Placenta Complete sequencing and characterization of 21,243 full-length human cDNAs. NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] VARIANT CYS-334 Pericardium Human chromosome 11 DNA sequence and analysis including novel gene identification. NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] VARIANT PRO-46 NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] VARIANT CYS-334 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] VARIANT SER-312 Kidney Leukocyte Receptor for ATP and UTP coupled to G-proteins that activate a phosphatidylinositol-calcium second messenger system. The affinity range is UTP = ATP > ATP-gamma-S >> 2-methylthio-ATP = ADP. Cell membrane Multi-pass membrane protein Spleen, testis, kidney, liver, lung, heart and brain. Belongs to the G-protein coupled receptor 1 family. 3D-structure Cell membrane Complete proteome Disulfide bond G-protein coupled receptor Glycoprotein Membrane Polymorphism Receptor Transducer Transmembrane L P R S R C E G S F MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVLGLCLNAVALYIFLC RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR RTESTPAGSENTKDIRL Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License