Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P41161

- ETV5_HUMAN

UniProt

P41161 - ETV5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

ETS translocation variant 5

Gene

ETV5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Binds to DNA sequences containing the consensus nucleotide core sequence GGAA.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi368 – 44881ETSPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: ProtInc
  2. RNA polymerase II regulatory region sequence-specific DNA binding Source: NTNU_SB
  3. RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB
  4. sequence-specific DNA binding RNA polymerase II transcription factor activity Source: RefGenome
  5. sequence-specific DNA binding transcription factor activity Source: UniProtKB
  6. transcription regulatory region DNA binding Source: UniProtKB

GO - Biological processi

  1. cell differentiation Source: RefGenome
  2. cellular response to oxidative stress Source: UniProtKB
  3. locomotory behavior Source: Ensembl
  4. male germ-line stem cell asymmetric division Source: Ensembl
  5. neuromuscular synaptic transmission Source: Ensembl
  6. positive regulation of glial cell proliferation Source: Ensembl
  7. positive regulation of neuron differentiation Source: Ensembl
  8. positive regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
  9. regulation of branching involved in mammary gland duct morphogenesis Source: Ensembl
  10. regulation of synapse organization Source: Ensembl
  11. regulation of transcription from RNA polymerase II promoter Source: RefGenome
  12. skeletal muscle acetylcholine-gated channel clustering Source: Ensembl
  13. transcription from RNA polymerase II promoter Source: GOC
Complete GO annotation...

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
ETS translocation variant 5
Alternative name(s):
Ets-related protein ERM
Gene namesi
Name:ETV5
Synonyms:ERM
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:3494. ETV5.

Subcellular locationi

GO - Cellular componenti

  1. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27908.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 510510ETS translocation variant 5PRO_0000204118Add
BLAST

Proteomic databases

PaxDbiP41161.
PRIDEiP41161.

PTM databases

PhosphoSiteiP41161.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiP41161.
CleanExiHS_ETV5.
ExpressionAtlasiP41161. baseline and differential.
GenevestigatoriP41161.

Organism-specific databases

HPAiCAB009590.

Interactioni

Protein-protein interaction databases

BioGridi108420. 21 interactions.
IntActiP41161. 11 interactions.
STRINGi9606.ENSP00000306894.

Structurei

Secondary structure

1
510
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi370 – 37910Combined sources
Helixi381 – 3833Combined sources
Turni384 – 3863Combined sources
Beta strandi395 – 3973Combined sources
Helixi401 – 41111Combined sources
Helixi419 – 43113Combined sources
Beta strandi434 – 4374Combined sources
Beta strandi444 – 4474Combined sources
Helixi451 – 4588Combined sources

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4UNOX-ray1.95A365-462[»]
ProteinModelPortaliP41161.
SMRiP41161. Positions 367-461.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ETS family.Curated
Contains 1 ETS DNA-binding domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG258471.
GeneTreeiENSGT00760000118907.
HOVERGENiHBG000231.
InParanoidiP41161.
KOiK15593.
PhylomeDBiP41161.
TreeFamiTF316214.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR000418. Ets_dom.
IPR006715. ETS_PEA3_N.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00178. Ets. 1 hit.
PF04621. ETS_PEA3_N. 1 hit.
[Graphical view]
PRINTSiPR00454. ETSDOMAIN.
SMARTiSM00413. ETS. 1 hit.
[Graphical view]
PROSITEiPS00345. ETS_DOMAIN_1. 1 hit.
PS00346. ETS_DOMAIN_2. 1 hit.
PS50061. ETS_DOMAIN_3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P41161-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDGFYDQQVP FMVPGKSRSE ECRGRPVIDR KRKFLDTDLA HDSEELFQDL
60 70 80 90 100
SQLQEAWLAE AQVPDDEQFV PDFQSDNLVL HAPPPTKIKR ELHSPSSELS
110 120 130 140 150
SCSHEQALGA NYGEKCLYNY CAYDRKPPSG FKPLTPPTTP LSPTHQNPLF
160 170 180 190 200
PPPQATLPTS GHAPAAGPVQ GVGPAPAPHS LPEPGPQQQT FAVPRPPHQP
210 220 230 240 250
LQMPKMMPEN QYPSEQRFQR QLSEPCHPFP PQPGVPGDNR PSYHRQMSEP
260 270 280 290 300
IVPAAPPPPQ GFKQEYHDPL YEHGVPGMPG PPAHGFQSPM GIKQEPRDYC
310 320 330 340 350
VDSEVPNCQS SYMRGGYFSS SHEGFSYEKD PRLYFDDTCV VPERLEGKVK
360 370 380 390 400
QEPTMYREGP PYQRRGSLQL WQFLVTLLDD PANAHFIAWT GRGMEFKLIE
410 420 430 440 450
PEEVARRWGI QKNRPAMNYD KLSRSLRYYY EKGIMQKVAG ERYVYKFVCD
460 470 480 490 500
PDALFSMAFP DNQRPFLKAE SECHLSEEDT LPLTHFEDSP AYLLDMDRCS
510
SLPYAEGFAY
Length:510
Mass (Da):57,838
Last modified:February 1, 1995 - v1
Checksum:iB7CE40A33927F46E
GO
Isoform 2 (identifier: P41161-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSERRCPPEHREGVNDTGGSLFPQKLLNAETSQSGIRDAESTM

Note: No experimental confirmation available.

Show »
Length:552
Mass (Da):62,422
Checksum:iAE21DD036DB1BC24
GO

Mass spectrometryi

Molecular mass is 57837.98 Da from positions 1 - 510. Determined by MALDI. 1 Publication

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti348 – 3481K → R.
Corresponds to variant rs2228269 [ dbSNP | Ensembl ].
VAR_048951

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MSERRCPPEHREGVNDTGGS LFPQKLLNAETSQSGIRDAE STM in isoform 2. 1 PublicationVSP_055489

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X76184 mRNA. Translation: CAA53778.1.
X96381
, X96380, X96382, X96379, X96378, X96377, X96376, X96375 Genomic DNA. Translation: CAA65246.1.
AK301878 mRNA. Translation: BAH13573.1.
CR456767 mRNA. Translation: CAG33048.1.
BT006713 mRNA. Translation: AAP35359.1.
AC108671 Genomic DNA. No translation available.
AC112649 Genomic DNA. No translation available.
AC131156 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78200.1.
BC007333 mRNA. Translation: AAH07333.1.
CCDSiCCDS33906.1. [P41161-1]
PIRiS43692.
RefSeqiNP_004445.1. NM_004454.2. [P41161-1]
UniGeneiHs.43697.

Genome annotation databases

EnsembliENST00000306376; ENSP00000306894; ENSG00000244405. [P41161-1]
ENST00000434744; ENSP00000413755; ENSG00000244405. [P41161-1]
GeneIDi2119.
KEGGihsa:2119.
UCSCiuc003fpz.3. human. [P41161-1]

Polymorphism databases

DMDMi729441.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X76184 mRNA. Translation: CAA53778.1 .
X96381
, X96380 , X96382 , X96379 , X96378 , X96377 , X96376 , X96375 Genomic DNA. Translation: CAA65246.1 .
AK301878 mRNA. Translation: BAH13573.1 .
CR456767 mRNA. Translation: CAG33048.1 .
BT006713 mRNA. Translation: AAP35359.1 .
AC108671 Genomic DNA. No translation available.
AC112649 Genomic DNA. No translation available.
AC131156 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78200.1 .
BC007333 mRNA. Translation: AAH07333.1 .
CCDSi CCDS33906.1. [P41161-1 ]
PIRi S43692.
RefSeqi NP_004445.1. NM_004454.2. [P41161-1 ]
UniGenei Hs.43697.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4UNO X-ray 1.95 A 365-462 [» ]
ProteinModelPortali P41161.
SMRi P41161. Positions 367-461.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108420. 21 interactions.
IntActi P41161. 11 interactions.
STRINGi 9606.ENSP00000306894.

PTM databases

PhosphoSitei P41161.

Polymorphism databases

DMDMi 729441.

Proteomic databases

PaxDbi P41161.
PRIDEi P41161.

Protocols and materials databases

DNASUi 2119.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000306376 ; ENSP00000306894 ; ENSG00000244405 . [P41161-1 ]
ENST00000434744 ; ENSP00000413755 ; ENSG00000244405 . [P41161-1 ]
GeneIDi 2119.
KEGGi hsa:2119.
UCSCi uc003fpz.3. human. [P41161-1 ]

Organism-specific databases

CTDi 2119.
GeneCardsi GC03M185764.
HGNCi HGNC:3494. ETV5.
HPAi CAB009590.
MIMi 601600. gene.
neXtProti NX_P41161.
PharmGKBi PA27908.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG258471.
GeneTreei ENSGT00760000118907.
HOVERGENi HBG000231.
InParanoidi P41161.
KOi K15593.
PhylomeDBi P41161.
TreeFami TF316214.

Miscellaneous databases

ChiTaRSi ETV5. human.
GenomeRNAii 2119.
NextBioi 35480205.
PROi P41161.
SOURCEi Search...

Gene expression databases

Bgeei P41161.
CleanExi HS_ETV5.
ExpressionAtlasi P41161. baseline and differential.
Genevestigatori P41161.

Family and domain databases

Gene3Di 1.10.10.10. 1 hit.
InterProi IPR000418. Ets_dom.
IPR006715. ETS_PEA3_N.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view ]
Pfami PF00178. Ets. 1 hit.
PF04621. ETS_PEA3_N. 1 hit.
[Graphical view ]
PRINTSi PR00454. ETSDOMAIN.
SMARTi SM00413. ETS. 1 hit.
[Graphical view ]
PROSITEi PS00345. ETS_DOMAIN_1. 1 hit.
PS00346. ETS_DOMAIN_2. 1 hit.
PS50061. ETS_DOMAIN_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of human ERM, a new member of the Ets family closely related to mouse PEA3 and ER81 transcription factors."
    Monte D., Baert J.-L., Defossez P.-A., de Launoit Y., Stehelin D.
    Oncogene 9:1397-1406(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. "Genomic organization of the human ERM (ETV5) gene, a PEA3 group member of ETS transcription factors."
    Monte D., Coutte L., Dewitte F., Defossez P.-A., le Coniat D., Stehelin R., Berger Y., de Launoit Y.
    Genomics 35:236-240(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  4. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  5. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Skin.
  9. "Cluster analysis of an extensive human breast cancer cell line protein expression map database."
    Harris R.A., Yang A., Stein R.C., Lucy K., Brusten L., Herath A., Parekh R., Waterfield M.D., O'Hare M.J., Neville M.A., Page M.J., Zvelebil M.J.
    Proteomics 2:212-223(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: MASS SPECTROMETRY.
    Tissue: Mammary cancer.

Entry informationi

Entry nameiETV5_HUMAN
AccessioniPrimary (citable) accession number: P41161
Secondary accession number(s): A6NH46, B7Z7D7, Q6IBN5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: October 29, 2014
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3