Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ETS translocation variant 5

Gene

ETV5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds to DNA sequences containing the consensus nucleotide core sequence 5'-GGAA.-3'.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi368 – 448ETSPROSITE-ProRule annotationAdd BLAST81

GO - Molecular functioni

  • DNA binding Source: ProtInc
  • RNA polymerase II regulatory region sequence-specific DNA binding Source: NTNU_SB
  • transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding Source: NTNU_SB
  • transcription factor activity, sequence-specific DNA binding Source: UniProtKB
  • transcription regulatory region DNA binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:G66-31345-MONOMER.
SIGNORiP41161.

Names & Taxonomyi

Protein namesi
Recommended name:
ETS translocation variant 5
Alternative name(s):
Ets-related protein ERM
Gene namesi
Name:ETV5
Synonyms:ERM
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:3494. ETV5.

Subcellular locationi

GO - Cellular componenti

  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • plasma membrane Source: GOC
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi2119.
OpenTargetsiENSG00000244405.
PharmGKBiPA27908.

Polymorphism and mutation databases

BioMutaiETV5.
DMDMi729441.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002041181 – 510ETS translocation variant 5Add BLAST510

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei248PhosphoserineCombined sources1
Cross-linki350Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiP41161.
PeptideAtlasiP41161.
PRIDEiP41161.

PTM databases

iPTMnetiP41161.
PhosphoSitePlusiP41161.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiENSG00000244405.
CleanExiHS_ETV5.
ExpressionAtlasiP41161. baseline and differential.
GenevisibleiP41161. HS.

Organism-specific databases

HPAiCAB009590.
HPA063065.

Interactioni

Subunit structurei

Interacts (via C-terminal) with ZMYM5 (via N-terminal 120 amino acid region).1 Publication

Protein-protein interaction databases

BioGridi108420. 20 interactors.
IntActiP41161. 12 interactors.
STRINGi9606.ENSP00000306894.

Structurei

Secondary structure

1510
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi370 – 379Combined sources10
Helixi381 – 383Combined sources3
Turni384 – 386Combined sources3
Beta strandi395 – 397Combined sources3
Helixi401 – 411Combined sources11
Helixi419 – 431Combined sources13
Beta strandi434 – 437Combined sources4
Beta strandi444 – 447Combined sources4
Helixi451 – 458Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4UNOX-ray1.95A365-462[»]
ProteinModelPortaliP41161.
SMRiP41161.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ETS family.Curated
Contains 1 ETS DNA-binding domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3806. Eukaryota.
ENOG410Z0ZF. LUCA.
GeneTreeiENSGT00760000118907.
HOGENOMiHOG000230986.
HOVERGENiHBG000231.
InParanoidiP41161.
KOiK15593.
OMAiLDMDRCS.
OrthoDBiEOG091G04YU.
PhylomeDBiP41161.
TreeFamiTF316214.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR000418. Ets_dom.
IPR006715. ETS_PEA3_N.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00178. Ets. 1 hit.
PF04621. ETS_PEA3_N. 1 hit.
[Graphical view]
PRINTSiPR00454. ETSDOMAIN.
SMARTiSM00413. ETS. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
PROSITEiPS00345. ETS_DOMAIN_1. 1 hit.
PS00346. ETS_DOMAIN_2. 1 hit.
PS50061. ETS_DOMAIN_3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P41161-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDGFYDQQVP FMVPGKSRSE ECRGRPVIDR KRKFLDTDLA HDSEELFQDL
60 70 80 90 100
SQLQEAWLAE AQVPDDEQFV PDFQSDNLVL HAPPPTKIKR ELHSPSSELS
110 120 130 140 150
SCSHEQALGA NYGEKCLYNY CAYDRKPPSG FKPLTPPTTP LSPTHQNPLF
160 170 180 190 200
PPPQATLPTS GHAPAAGPVQ GVGPAPAPHS LPEPGPQQQT FAVPRPPHQP
210 220 230 240 250
LQMPKMMPEN QYPSEQRFQR QLSEPCHPFP PQPGVPGDNR PSYHRQMSEP
260 270 280 290 300
IVPAAPPPPQ GFKQEYHDPL YEHGVPGMPG PPAHGFQSPM GIKQEPRDYC
310 320 330 340 350
VDSEVPNCQS SYMRGGYFSS SHEGFSYEKD PRLYFDDTCV VPERLEGKVK
360 370 380 390 400
QEPTMYREGP PYQRRGSLQL WQFLVTLLDD PANAHFIAWT GRGMEFKLIE
410 420 430 440 450
PEEVARRWGI QKNRPAMNYD KLSRSLRYYY EKGIMQKVAG ERYVYKFVCD
460 470 480 490 500
PDALFSMAFP DNQRPFLKAE SECHLSEEDT LPLTHFEDSP AYLLDMDRCS
510
SLPYAEGFAY
Length:510
Mass (Da):57,838
Last modified:February 1, 1995 - v1
Checksum:iB7CE40A33927F46E
GO
Isoform 2 (identifier: P41161-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSERRCPPEHREGVNDTGGSLFPQKLLNAETSQSGIRDAESTM

Note: No experimental confirmation available.
Show »
Length:552
Mass (Da):62,422
Checksum:iAE21DD036DB1BC24
GO

Mass spectrometryi

Molecular mass is 57837.98 Da from positions 1 - 510. Determined by MALDI. 1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048951348K → R.Corresponds to variant rs2228269dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0554891M → MSERRCPPEHREGVNDTGGS LFPQKLLNAETSQSGIRDAE STM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X76184 mRNA. Translation: CAA53778.1.
X96381
, X96380, X96382, X96379, X96378, X96377, X96376, X96375 Genomic DNA. Translation: CAA65246.1.
AK301878 mRNA. Translation: BAH13573.1.
CR456767 mRNA. Translation: CAG33048.1.
BT006713 mRNA. Translation: AAP35359.1.
AC108671 Genomic DNA. No translation available.
AC112649 Genomic DNA. No translation available.
AC131156 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78200.1.
BC007333 mRNA. Translation: AAH07333.1.
CCDSiCCDS33906.1. [P41161-1]
PIRiS43692.
RefSeqiNP_004445.1. NM_004454.2. [P41161-1]
UniGeneiHs.43697.

Genome annotation databases

EnsembliENST00000306376; ENSP00000306894; ENSG00000244405. [P41161-1]
ENST00000434744; ENSP00000413755; ENSG00000244405. [P41161-1]
GeneIDi2119.
KEGGihsa:2119.
UCSCiuc003fpz.4. human. [P41161-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X76184 mRNA. Translation: CAA53778.1.
X96381
, X96380, X96382, X96379, X96378, X96377, X96376, X96375 Genomic DNA. Translation: CAA65246.1.
AK301878 mRNA. Translation: BAH13573.1.
CR456767 mRNA. Translation: CAG33048.1.
BT006713 mRNA. Translation: AAP35359.1.
AC108671 Genomic DNA. No translation available.
AC112649 Genomic DNA. No translation available.
AC131156 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78200.1.
BC007333 mRNA. Translation: AAH07333.1.
CCDSiCCDS33906.1. [P41161-1]
PIRiS43692.
RefSeqiNP_004445.1. NM_004454.2. [P41161-1]
UniGeneiHs.43697.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4UNOX-ray1.95A365-462[»]
ProteinModelPortaliP41161.
SMRiP41161.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108420. 20 interactors.
IntActiP41161. 12 interactors.
STRINGi9606.ENSP00000306894.

PTM databases

iPTMnetiP41161.
PhosphoSitePlusiP41161.

Polymorphism and mutation databases

BioMutaiETV5.
DMDMi729441.

Proteomic databases

PaxDbiP41161.
PeptideAtlasiP41161.
PRIDEiP41161.

Protocols and materials databases

DNASUi2119.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306376; ENSP00000306894; ENSG00000244405. [P41161-1]
ENST00000434744; ENSP00000413755; ENSG00000244405. [P41161-1]
GeneIDi2119.
KEGGihsa:2119.
UCSCiuc003fpz.4. human. [P41161-1]

Organism-specific databases

CTDi2119.
DisGeNETi2119.
GeneCardsiETV5.
HGNCiHGNC:3494. ETV5.
HPAiCAB009590.
HPA063065.
MIMi601600. gene.
neXtProtiNX_P41161.
OpenTargetsiENSG00000244405.
PharmGKBiPA27908.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3806. Eukaryota.
ENOG410Z0ZF. LUCA.
GeneTreeiENSGT00760000118907.
HOGENOMiHOG000230986.
HOVERGENiHBG000231.
InParanoidiP41161.
KOiK15593.
OMAiLDMDRCS.
OrthoDBiEOG091G04YU.
PhylomeDBiP41161.
TreeFamiTF316214.

Enzyme and pathway databases

BioCyciZFISH:G66-31345-MONOMER.
SIGNORiP41161.

Miscellaneous databases

ChiTaRSiETV5. human.
GenomeRNAii2119.
PROiP41161.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000244405.
CleanExiHS_ETV5.
ExpressionAtlasiP41161. baseline and differential.
GenevisibleiP41161. HS.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR000418. Ets_dom.
IPR006715. ETS_PEA3_N.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00178. Ets. 1 hit.
PF04621. ETS_PEA3_N. 1 hit.
[Graphical view]
PRINTSiPR00454. ETSDOMAIN.
SMARTiSM00413. ETS. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
PROSITEiPS00345. ETS_DOMAIN_1. 1 hit.
PS00346. ETS_DOMAIN_2. 1 hit.
PS50061. ETS_DOMAIN_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiETV5_HUMAN
AccessioniPrimary (citable) accession number: P41161
Secondary accession number(s): A6NH46, B7Z7D7, Q6IBN5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: November 2, 2016
This is version 150 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.