Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P41161

- ETV5_HUMAN

UniProt

P41161 - ETV5_HUMAN

Protein

ETS translocation variant 5

Gene

ETV5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 130 (01 Oct 2014)
      Sequence version 1 (01 Feb 1995)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Binds to DNA sequences containing the consensus nucleotide core sequence GGAA.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi368 – 44881ETSPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: ProtInc
    2. RNA polymerase II regulatory region sequence-specific DNA binding Source: NTNU_SB
    3. RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB
    4. sequence-specific DNA binding Source: InterPro
    5. sequence-specific DNA binding RNA polymerase II transcription factor activity Source: RefGenome
    6. sequence-specific DNA binding transcription factor activity Source: UniProtKB
    7. transcription regulatory region DNA binding Source: UniProtKB

    GO - Biological processi

    1. cell differentiation Source: RefGenome
    2. cellular response to oxidative stress Source: UniProtKB
    3. locomotory behavior Source: Ensembl
    4. male germ-line stem cell asymmetric division Source: Ensembl
    5. neuromuscular synaptic transmission Source: Ensembl
    6. positive regulation of glial cell proliferation Source: Ensembl
    7. positive regulation of neuron differentiation Source: Ensembl
    8. positive regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
    9. regulation of branching involved in mammary gland duct morphogenesis Source: Ensembl
    10. regulation of synapse organization Source: Ensembl
    11. regulation of transcription from RNA polymerase II promoter Source: RefGenome
    12. skeletal muscle acetylcholine-gated channel clustering Source: Ensembl
    13. transcription from RNA polymerase II promoter Source: GOC

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    ETS translocation variant 5
    Alternative name(s):
    Ets-related protein ERM
    Gene namesi
    Name:ETV5
    Synonyms:ERM
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:3494. ETV5.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA27908.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 510510ETS translocation variant 5PRO_0000204118Add
    BLAST

    Proteomic databases

    PaxDbiP41161.
    PRIDEiP41161.

    PTM databases

    PhosphoSiteiP41161.

    Expressioni

    Tissue specificityi

    Ubiquitous.

    Gene expression databases

    ArrayExpressiP41161.
    BgeeiP41161.
    CleanExiHS_ETV5.
    GenevestigatoriP41161.

    Organism-specific databases

    HPAiCAB009590.

    Interactioni

    Protein-protein interaction databases

    BioGridi108420. 17 interactions.
    IntActiP41161. 10 interactions.
    STRINGi9606.ENSP00000306894.

    Structurei

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    4UNOX-ray1.95A365-462[»]
    ProteinModelPortaliP41161.
    SMRiP41161. Positions 367-459.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the ETS family.Curated
    Contains 1 ETS DNA-binding domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG258471.
    HOVERGENiHBG000231.
    InParanoidiP41161.
    KOiK15593.
    PhylomeDBiP41161.
    TreeFamiTF316214.

    Family and domain databases

    Gene3Di1.10.10.10. 1 hit.
    InterProiIPR000418. Ets_dom.
    IPR006715. ETS_PEA3_N.
    IPR011991. WHTH_DNA-bd_dom.
    [Graphical view]
    PfamiPF00178. Ets. 1 hit.
    PF04621. ETS_PEA3_N. 1 hit.
    [Graphical view]
    PRINTSiPR00454. ETSDOMAIN.
    SMARTiSM00413. ETS. 1 hit.
    [Graphical view]
    PROSITEiPS00345. ETS_DOMAIN_1. 1 hit.
    PS00346. ETS_DOMAIN_2. 1 hit.
    PS50061. ETS_DOMAIN_3. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P41161-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDGFYDQQVP FMVPGKSRSE ECRGRPVIDR KRKFLDTDLA HDSEELFQDL    50
    SQLQEAWLAE AQVPDDEQFV PDFQSDNLVL HAPPPTKIKR ELHSPSSELS 100
    SCSHEQALGA NYGEKCLYNY CAYDRKPPSG FKPLTPPTTP LSPTHQNPLF 150
    PPPQATLPTS GHAPAAGPVQ GVGPAPAPHS LPEPGPQQQT FAVPRPPHQP 200
    LQMPKMMPEN QYPSEQRFQR QLSEPCHPFP PQPGVPGDNR PSYHRQMSEP 250
    IVPAAPPPPQ GFKQEYHDPL YEHGVPGMPG PPAHGFQSPM GIKQEPRDYC 300
    VDSEVPNCQS SYMRGGYFSS SHEGFSYEKD PRLYFDDTCV VPERLEGKVK 350
    QEPTMYREGP PYQRRGSLQL WQFLVTLLDD PANAHFIAWT GRGMEFKLIE 400
    PEEVARRWGI QKNRPAMNYD KLSRSLRYYY EKGIMQKVAG ERYVYKFVCD 450
    PDALFSMAFP DNQRPFLKAE SECHLSEEDT LPLTHFEDSP AYLLDMDRCS 500
    SLPYAEGFAY 510
    Length:510
    Mass (Da):57,838
    Last modified:February 1, 1995 - v1
    Checksum:iB7CE40A33927F46E
    GO
    Isoform 2 (identifier: P41161-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSERRCPPEHREGVNDTGGSLFPQKLLNAETSQSGIRDAESTM

    Note: No experimental confirmation available.

    Show »
    Length:552
    Mass (Da):62,422
    Checksum:iAE21DD036DB1BC24
    GO

    Mass spectrometryi

    Molecular mass is 57837.98 Da from positions 1 - 510. Determined by MALDI. 1 Publication

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti348 – 3481K → R.
    Corresponds to variant rs2228269 [ dbSNP | Ensembl ].
    VAR_048951

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MSERRCPPEHREGVNDTGGS LFPQKLLNAETSQSGIRDAE STM in isoform 2. 1 PublicationVSP_055489

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X76184 mRNA. Translation: CAA53778.1.
    X96381
    , X96380, X96382, X96379, X96378, X96377, X96376, X96375 Genomic DNA. Translation: CAA65246.1.
    AK301878 mRNA. Translation: BAH13573.1.
    CR456767 mRNA. Translation: CAG33048.1.
    BT006713 mRNA. Translation: AAP35359.1.
    AC108671 Genomic DNA. No translation available.
    AC112649 Genomic DNA. No translation available.
    AC131156 Genomic DNA. No translation available.
    CH471052 Genomic DNA. Translation: EAW78200.1.
    BC007333 mRNA. Translation: AAH07333.1.
    CCDSiCCDS33906.1.
    PIRiS43692.
    RefSeqiNP_004445.1. NM_004454.2.
    UniGeneiHs.43697.

    Genome annotation databases

    EnsembliENST00000306376; ENSP00000306894; ENSG00000244405. [P41161-1]
    ENST00000434744; ENSP00000413755; ENSG00000244405. [P41161-1]
    GeneIDi2119.
    KEGGihsa:2119.
    UCSCiuc003fpz.3. human.

    Polymorphism databases

    DMDMi729441.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X76184 mRNA. Translation: CAA53778.1 .
    X96381
    , X96380 , X96382 , X96379 , X96378 , X96377 , X96376 , X96375 Genomic DNA. Translation: CAA65246.1 .
    AK301878 mRNA. Translation: BAH13573.1 .
    CR456767 mRNA. Translation: CAG33048.1 .
    BT006713 mRNA. Translation: AAP35359.1 .
    AC108671 Genomic DNA. No translation available.
    AC112649 Genomic DNA. No translation available.
    AC131156 Genomic DNA. No translation available.
    CH471052 Genomic DNA. Translation: EAW78200.1 .
    BC007333 mRNA. Translation: AAH07333.1 .
    CCDSi CCDS33906.1.
    PIRi S43692.
    RefSeqi NP_004445.1. NM_004454.2.
    UniGenei Hs.43697.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    4UNO X-ray 1.95 A 365-462 [» ]
    ProteinModelPortali P41161.
    SMRi P41161. Positions 367-459.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 108420. 17 interactions.
    IntActi P41161. 10 interactions.
    STRINGi 9606.ENSP00000306894.

    PTM databases

    PhosphoSitei P41161.

    Polymorphism databases

    DMDMi 729441.

    Proteomic databases

    PaxDbi P41161.
    PRIDEi P41161.

    Protocols and materials databases

    DNASUi 2119.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000306376 ; ENSP00000306894 ; ENSG00000244405 . [P41161-1 ]
    ENST00000434744 ; ENSP00000413755 ; ENSG00000244405 . [P41161-1 ]
    GeneIDi 2119.
    KEGGi hsa:2119.
    UCSCi uc003fpz.3. human.

    Organism-specific databases

    CTDi 2119.
    GeneCardsi GC03M185764.
    HGNCi HGNC:3494. ETV5.
    HPAi CAB009590.
    MIMi 601600. gene.
    neXtProti NX_P41161.
    PharmGKBi PA27908.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG258471.
    HOVERGENi HBG000231.
    InParanoidi P41161.
    KOi K15593.
    PhylomeDBi P41161.
    TreeFami TF316214.

    Miscellaneous databases

    ChiTaRSi ETV5. human.
    GenomeRNAii 2119.
    NextBioi 8565.
    PROi P41161.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P41161.
    Bgeei P41161.
    CleanExi HS_ETV5.
    Genevestigatori P41161.

    Family and domain databases

    Gene3Di 1.10.10.10. 1 hit.
    InterProi IPR000418. Ets_dom.
    IPR006715. ETS_PEA3_N.
    IPR011991. WHTH_DNA-bd_dom.
    [Graphical view ]
    Pfami PF00178. Ets. 1 hit.
    PF04621. ETS_PEA3_N. 1 hit.
    [Graphical view ]
    PRINTSi PR00454. ETSDOMAIN.
    SMARTi SM00413. ETS. 1 hit.
    [Graphical view ]
    PROSITEi PS00345. ETS_DOMAIN_1. 1 hit.
    PS00346. ETS_DOMAIN_2. 1 hit.
    PS50061. ETS_DOMAIN_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and characterization of human ERM, a new member of the Ets family closely related to mouse PEA3 and ER81 transcription factors."
      Monte D., Baert J.-L., Defossez P.-A., de Launoit Y., Stehelin D.
      Oncogene 9:1397-1406(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Testis.
    2. "Genomic organization of the human ERM (ETV5) gene, a PEA3 group member of ETS transcription factors."
      Monte D., Coutte L., Dewitte F., Defossez P.-A., le Coniat D., Stehelin R., Berger Y., de Launoit Y.
      Genomics 35:236-240(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    4. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    5. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Skin.
    9. "Cluster analysis of an extensive human breast cancer cell line protein expression map database."
      Harris R.A., Yang A., Stein R.C., Lucy K., Brusten L., Herath A., Parekh R., Waterfield M.D., O'Hare M.J., Neville M.A., Page M.J., Zvelebil M.J.
      Proteomics 2:212-223(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: MASS SPECTROMETRY.
      Tissue: Mammary cancer.

    Entry informationi

    Entry nameiETV5_HUMAN
    AccessioniPrimary (citable) accession number: P41161
    Secondary accession number(s): A6NH46, B7Z7D7, Q6IBN5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1995
    Last sequence update: February 1, 1995
    Last modified: October 1, 2014
    This is version 130 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3