Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Replication factor C subunit 3

Gene

RFC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.

GO - Molecular functioni

  • DNA clamp loader activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

DNA replication

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000133119-MONOMER.
ReactomeiR-HSA-110312. Translesion synthesis by REV1.
R-HSA-110314. Recognition of DNA damage by PCNA-containing replication complex.
R-HSA-110320. Translesion Synthesis by POLH.
R-HSA-174411. Polymerase switching on the C-strand of the telomere.
R-HSA-176187. Activation of ATR in response to replication stress.
R-HSA-5651801. PCNA-Dependent Long Patch Base Excision Repair.
R-HSA-5655862. Translesion synthesis by POLK.
R-HSA-5656121. Translesion synthesis by POLI.
R-HSA-5656169. Termination of translesion DNA synthesis.
R-HSA-5685938. HDR through Single Strand Annealing (SSA).
R-HSA-5685942. HDR through Homologous Recombination (HRR).
R-HSA-5693607. Processing of DNA double-strand break ends.
R-HSA-5693616. Presynaptic phase of homologous DNA pairing and strand exchange.
R-HSA-5696397. Gap-filling DNA repair synthesis and ligation in GG-NER.
R-HSA-5696400. Dual Incision in GG-NER.
R-HSA-6782135. Dual incision in TC-NER.
R-HSA-6782210. Gap-filling DNA repair synthesis and ligation in TC-NER.
R-HSA-6804756. Regulation of TP53 Activity through Phosphorylation.
R-HSA-69091. Polymerase switching.
R-HSA-69473. G2/M DNA damage checkpoint.

Names & Taxonomyi

Protein namesi
Recommended name:
Replication factor C subunit 3
Alternative name(s):
Activator 1 38 kDa subunit
Short name:
A1 38 kDa subunit
Activator 1 subunit 3
Replication factor C 38 kDa subunit
Short name:
RF-C 38 kDa subunit
Short name:
RFC38
Gene namesi
Name:RFC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:9971. RFC3.

Subcellular locationi

GO - Cellular componenti

  • Ctf18 RFC-like complex Source: UniProtKB
  • DNA replication factor C complex Source: UniProtKB
  • nucleoplasm Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi5983.
OpenTargetsiENSG00000133119.
PharmGKBiPA34340.

Polymorphism and mutation databases

BioMutaiRFC3.
DMDMi3915601.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001217611 – 356Replication factor C subunit 3Add BLAST356

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei20N6-acetyllysineCombined sources1
Modified residuei125PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP40938.
MaxQBiP40938.
PaxDbiP40938.
PeptideAtlasiP40938.
PRIDEiP40938.

PTM databases

iPTMnetiP40938.
PhosphoSitePlusiP40938.
SwissPalmiP40938.

Expressioni

Gene expression databases

BgeeiENSG00000133119.
CleanExiHS_RFC3.
ExpressionAtlasiP40938. baseline and differential.
GenevisibleiP40938. HS.

Organism-specific databases

HPAiHPA030149.

Interactioni

Subunit structurei

Heterotetramer of subunits RFC2, RFC3, RFC4 and RFC5 that can form a complex either with RFC1 or with RAD17. The former interacts with PCNA in the presence of ATP, while the latter has ATPase activity but is not stimulated by PCNA.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
RFC4P352497EBI-1055010,EBI-476655

Protein-protein interaction databases

BioGridi111915. 51 interactors.
DIPiDIP-36432N.
IntActiP40938. 29 interactors.
MINTiMINT-3015032.
STRINGi9606.ENSP00000369411.

Structurei

3D structure databases

ProteinModelPortaliP40938.
SMRiP40938.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the activator 1 small subunits family.Curated

Phylogenomic databases

eggNOGiKOG2035. Eukaryota.
COG0470. LUCA.
GeneTreeiENSGT00550000075006.
HOGENOMiHOG000224153.
HOVERGENiHBG040509.
InParanoidiP40938.
KOiK10756.
OMAiQREFKVV.
OrthoDBiEOG091G0BQF.
PhylomeDBiP40938.
TreeFamiTF105724.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR003593. AAA+_ATPase.
IPR008921. DNA_pol3_clamp-load_cplx_C.
IPR027417. P-loop_NTPase.
[Graphical view]
SMARTiSM00382. AAA. 1 hit.
[Graphical view]
SUPFAMiSSF48019. SSF48019. 1 hit.
SSF52540. SSF52540. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P40938-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLWVDKYRP CSLGRLDYHK EQAAQLRNLV QCGDFPHLLV YGPSGAGKKT
60 70 80 90 100
RIMCILRELY GVGVEKLRIE HQTITTPSKK KIEISTIASN YHLEVNPSDA
110 120 130 140 150
GNSDRVVIQE MLKTVAQSQQ LETNSQRDFK VVLLTEVDKL TKDAQHALRR
160 170 180 190 200
TMEKYMSTCR LILCCNSTSK VIPPIRSRCL AVRVPAPSIE DICHVLSTVC
210 220 230 240 250
KKEGLNLPSQ LAHRLAEKSC RNLRKALLMC EACRVQQYPF TADQEIPETD
260 270 280 290 300
WEVYLRETAN AIVSQQTPQR LLEVRGRLYE LLTHCIPPEI IMKGLLSELL
310 320 330 340 350
HNCDGQLKGE VAQMAAYYEH RLQLGSKAIY HLEAFVAKFM ALYKKFMEDG

LEGMMF
Length:356
Mass (Da):40,556
Last modified:December 15, 1998 - v2
Checksum:i820C11675A2C63A5
GO
Isoform 2 (identifier: P40938-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     294-356: GLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF → ACKEESRSCDIF

Note: No experimental confirmation available.
Show »
Length:305
Mass (Da):34,756
Checksum:i2835F2D0A4DDF1E4
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01875016L → V.1 PublicationCorresponds to variant rs3135533dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044920294 – 356GLLSE…EGMMF → ACKEESRSCDIF in isoform 2. 1 PublicationAdd BLAST63

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L07541 mRNA. Translation: AAB07268.1.
AF484446 Genomic DNA. Translation: AAL82505.1.
AL139081 Genomic DNA. Translation: CAH70947.1.
AL160394 Genomic DNA. No translation available.
AL161891 Genomic DNA. No translation available.
CH471075 Genomic DNA. Translation: EAX08537.1.
BC000149 mRNA. Translation: AAH00149.1.
CX786577 mRNA. No translation available.
CCDSiCCDS45025.1. [P40938-2]
CCDS9352.1. [P40938-1]
PIRiT09573.
RefSeqiNP_002906.1. NM_002915.3. [P40938-1]
NP_853536.2. NM_181558.2. [P40938-2]
UniGeneiHs.115474.
Hs.661994.

Genome annotation databases

EnsembliENST00000380071; ENSP00000369411; ENSG00000133119. [P40938-1]
ENST00000434425; ENSP00000401001; ENSG00000133119. [P40938-2]
GeneIDi5983.
KEGGihsa:5983.
UCSCiuc001uuz.4. human. [P40938-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L07541 mRNA. Translation: AAB07268.1.
AF484446 Genomic DNA. Translation: AAL82505.1.
AL139081 Genomic DNA. Translation: CAH70947.1.
AL160394 Genomic DNA. No translation available.
AL161891 Genomic DNA. No translation available.
CH471075 Genomic DNA. Translation: EAX08537.1.
BC000149 mRNA. Translation: AAH00149.1.
CX786577 mRNA. No translation available.
CCDSiCCDS45025.1. [P40938-2]
CCDS9352.1. [P40938-1]
PIRiT09573.
RefSeqiNP_002906.1. NM_002915.3. [P40938-1]
NP_853536.2. NM_181558.2. [P40938-2]
UniGeneiHs.115474.
Hs.661994.

3D structure databases

ProteinModelPortaliP40938.
SMRiP40938.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111915. 51 interactors.
DIPiDIP-36432N.
IntActiP40938. 29 interactors.
MINTiMINT-3015032.
STRINGi9606.ENSP00000369411.

PTM databases

iPTMnetiP40938.
PhosphoSitePlusiP40938.
SwissPalmiP40938.

Polymorphism and mutation databases

BioMutaiRFC3.
DMDMi3915601.

Proteomic databases

EPDiP40938.
MaxQBiP40938.
PaxDbiP40938.
PeptideAtlasiP40938.
PRIDEiP40938.

Protocols and materials databases

DNASUi5983.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380071; ENSP00000369411; ENSG00000133119. [P40938-1]
ENST00000434425; ENSP00000401001; ENSG00000133119. [P40938-2]
GeneIDi5983.
KEGGihsa:5983.
UCSCiuc001uuz.4. human. [P40938-1]

Organism-specific databases

CTDi5983.
DisGeNETi5983.
GeneCardsiRFC3.
HGNCiHGNC:9971. RFC3.
HPAiHPA030149.
MIMi600405. gene.
neXtProtiNX_P40938.
OpenTargetsiENSG00000133119.
PharmGKBiPA34340.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2035. Eukaryota.
COG0470. LUCA.
GeneTreeiENSGT00550000075006.
HOGENOMiHOG000224153.
HOVERGENiHBG040509.
InParanoidiP40938.
KOiK10756.
OMAiQREFKVV.
OrthoDBiEOG091G0BQF.
PhylomeDBiP40938.
TreeFamiTF105724.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000133119-MONOMER.
ReactomeiR-HSA-110312. Translesion synthesis by REV1.
R-HSA-110314. Recognition of DNA damage by PCNA-containing replication complex.
R-HSA-110320. Translesion Synthesis by POLH.
R-HSA-174411. Polymerase switching on the C-strand of the telomere.
R-HSA-176187. Activation of ATR in response to replication stress.
R-HSA-5651801. PCNA-Dependent Long Patch Base Excision Repair.
R-HSA-5655862. Translesion synthesis by POLK.
R-HSA-5656121. Translesion synthesis by POLI.
R-HSA-5656169. Termination of translesion DNA synthesis.
R-HSA-5685938. HDR through Single Strand Annealing (SSA).
R-HSA-5685942. HDR through Homologous Recombination (HRR).
R-HSA-5693607. Processing of DNA double-strand break ends.
R-HSA-5693616. Presynaptic phase of homologous DNA pairing and strand exchange.
R-HSA-5696397. Gap-filling DNA repair synthesis and ligation in GG-NER.
R-HSA-5696400. Dual Incision in GG-NER.
R-HSA-6782135. Dual incision in TC-NER.
R-HSA-6782210. Gap-filling DNA repair synthesis and ligation in TC-NER.
R-HSA-6804756. Regulation of TP53 Activity through Phosphorylation.
R-HSA-69091. Polymerase switching.
R-HSA-69473. G2/M DNA damage checkpoint.

Miscellaneous databases

ChiTaRSiRFC3. human.
GeneWikiiRFC3.
GenomeRNAii5983.
PROiP40938.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000133119.
CleanExiHS_RFC3.
ExpressionAtlasiP40938. baseline and differential.
GenevisibleiP40938. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR003593. AAA+_ATPase.
IPR008921. DNA_pol3_clamp-load_cplx_C.
IPR027417. P-loop_NTPase.
[Graphical view]
SMARTiSM00382. AAA. 1 hit.
[Graphical view]
SUPFAMiSSF48019. SSF48019. 1 hit.
SSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiRFC3_HUMAN
AccessioniPrimary (citable) accession number: P40938
Secondary accession number(s): C9JU95, O15252, Q5W0E8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: December 15, 1998
Last modified: November 30, 2016
This is version 156 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.