P40933 (IL15_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Interleukin-15 Short name=IL-15 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 162 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha. |
| Subcellular location | Isoform IL15-S48AA: Secreted. Isoform IL15-S21AA: Cytoplasm. Nucleus. Note: IL15-S21AA is not secreted, but rather is stored intracellularly, appearing in the nucleus and cytoplasmic components. |
| Tissue specificity | Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus. |
| Sequence similarities | Belongs to the IL-15/IL-21 family. |
| Sequence caution | The sequence CAA71044.1 differs from that shown. Reason: Man-made cDNA construct with a sequence coding for signal peptide increasing the secretion of the protein (substitution with a signal peptide derived from the mouse IgV kappa chain). |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| IL15RA | Q13261 | 3 | EBI-980274,EBI-980354 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform IL15-S48AA (identifier: P40933-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform IL15-S21AA (identifier: P40933-2) The sequence of this isoform differs from the canonical sequence as follows: 1-37: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILG → MVLGTIDLCS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||
Molecule processing | |||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 29 | 29 | Potential | ||||||||||||||||||||
| Propeptide | 30 – 48 | 19 | Potential | PRO_0000015393 | |||||||||||||||||||
| Chain | 49 – 162 | 114 | Interleukin-15 | PRO_0000015394 | |||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||
| Glycosylation | 127 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||||||||||
| Disulfide bond | 83 ↔ 133 | By similarity | |||||||||||||||||||||
| Disulfide bond | 90 ↔ 136 | By similarity | |||||||||||||||||||||
Natural variations | |||||||||||||||||||||||
| Alternative sequence | 1 – 37 | 37 | MRISK…VFILG → MVLGTIDLCS in isoform IL15-S21AA. | VSP_002660 | |||||||||||||||||||
Experimental info | |||||||||||||||||||||||
| Sequence conflict | 141 | 1 | E → K in AAB97518. Ref.4 | ||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||
| Helix | 49 – 64 | 16 | |||||||||||||||||||||
| Beta strand | 73 – 75 | 3 | |||||||||||||||||||||
| Helix | 81 – 83 | 3 | |||||||||||||||||||||
| Helix | 84 – 102 | 19 | |||||||||||||||||||||
| Helix | 105 – 119 | 15 | |||||||||||||||||||||
| Helix | 136 – 138 | 3 | |||||||||||||||||||||
| Beta strand | 139 – 142 | 4 | |||||||||||||||||||||
| Helix | 144 – 158 | 15 | |||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of a T cell growth factor that interacts with the beta chain of the interleukin-2 receptor." Grabstein K.H., Eisenman J., Shanebeck K., Rauch C., Srinivasan S., Fung V., Beers C., Richardson J., Schoenborn M.A., Ahdieh M., Johnson L., Alderson M.R., Watson J.D., Anderson D.M., Giri J.G. Science 264:965-968(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S48AA). Tissue: Bone marrow. |
| [2] | "Genomic sequence and chromosomal location of the human interleukin-15 gene (IL15)." Krause H., Jandrig B., Wernicke C., Bulfone-Paus S., Pohl T., Diamantstein T. Cytokine 8:667-674(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "Identification of a novel interleukin-15 (IL-15) transcript isoform generated by alternative splicing in human small cell lung cancer cell lines." Meazza R., Verdiani S., Biassoni R., Coppolecchia M., Gaggero A., Orengo A.M., Colombo M.P., Azzarone B., Ferrini S. Oncogene 12:2187-2192(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA). Tissue: Lung cancer. |
| [4] | "Generation of secretable and nonsecretable interleukin 15 isoforms through alternate usage of signal peptides." Tagaya Y., Kurys G., Thies T.A., Losi J.M., Azimi N., Hanover J.A., Bamford R.N., Waldmann T.A. Proc. Natl. Acad. Sci. U.S.A. 94:14444-14449(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA). Tissue: Testis. |
| [5] | "Expression of two IL-15 mRNA isoforms in human tumors does not correlate with secretion: role of different signal peptides." Meazza R., Ferrini S. Submitted (APR-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM IL15-S48AA). Tissue: Colon. |
| [8] | "IL15 expression in human keratinocytes." Sorel M.A., Jacques Y. Submitted (OCT-1994) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 49-162. Tissue: Epidermis. |
| + | Additional computationally mapped references. |
Web resources
| R&D Systems' cytokine source book: IL-15 |
| Wikipedia Interleukin-15 entry |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U14407 mRNA. Translation: AAA21551.1. X91233 Genomic DNA. Translation: CAA62616.1. X94223 mRNA. Translation: CAA63914.1. X94222 mRNA. Translation: CAA63913.1. AF031167 mRNA. Translation: AAB97518.1. Y09908 mRNA. Translation: CAA71044.1. Sequence problems. CH471056 Genomic DNA. Translation: EAX05085.1. CH471056 Genomic DNA. Translation: EAX05087.1. BC018149 mRNA. Translation: AAH18149.1. BC100963 mRNA. Translation: AAI00964.1. Z38000 mRNA. Translation: CAA86100.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00031509. IPI00220638. | ||||||||||||||||||||||||||||||
| RefSeq | NP_000576.1. NM_000585.4. NP_751915.1. NM_172175.2. | ||||||||||||||||||||||||||||||
| UniGene | Hs.168132. Hs.602618. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | P40933. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| DIP | DIP-3046N. | ||||||||||||||||||||||||||||||
| IntAct | P40933. 1 interaction. | ||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000296545. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | P40933. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 729830. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PRIDE | P40933. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| DNASU | 3600. | ||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000296545; ENSP00000296545; ENSG00000164136. ENST00000320650; ENSP00000323505; ENSG00000164136. ENST00000394159; ENSP00000377714; ENSG00000164136. ENST00000477265; ENSP00000436914; ENSG00000164136. ENST00000514653; ENSP00000422271; ENSG00000164136. ENST00000529613; ENSP00000435462; ENSG00000164136. | ||||||||||||||||||||||||||||||
| GeneID | 3600. | ||||||||||||||||||||||||||||||
| KEGG | hsa:3600. | ||||||||||||||||||||||||||||||
| UCSC | uc003iis.3. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 3600. | ||||||||||||||||||||||||||||||
| GeneCards | GC04P142557. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:5977. IL15. | ||||||||||||||||||||||||||||||
| HPA | CAB004457. | ||||||||||||||||||||||||||||||
| MIM | 600554. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_P40933. | ||||||||||||||||||||||||||||||
| PharmGKB | PA29790. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | NOG44071. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG006142. | ||||||||||||||||||||||||||||||
| InParanoid | P40933. | ||||||||||||||||||||||||||||||
| KO | K05433. | ||||||||||||||||||||||||||||||
| OMA | RSTSIQC. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG40CHJ8. | ||||||||||||||||||||||||||||||
| PhylomeDB | P40933. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | P40933. | ||||||||||||||||||||||||||||||
| Bgee | P40933. | ||||||||||||||||||||||||||||||
| CleanEx | HS_IL15. | ||||||||||||||||||||||||||||||
| Genevestigator | P40933. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000164136. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR020439. Interleukin-15. IPR020466. Interleukin-15_mammal. IPR003443. Interleukin_15-like. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF02372. IL15. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PRINTS | PR01947. INTLKN15MAML. PR01930. INTRLEUKIN15. | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| EvolutionaryTrace | P40933. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 3600. | ||||||||||||||||||||||||||||||
| NextBio | 14065. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | IL15_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P40933 Secondary accession number(s): D3DNZ2 Q9UBA3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
