Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P40933 (IL15_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Interleukin-15

Short name=IL-15
Gene names
Name:IL15
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length162 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

Subcellular location

Isoform IL15-S48AA: Secreted.

Isoform IL15-S21AA: Cytoplasm. Nucleus. Note: IL15-S21AA is not secreted, but rather is stored intracellularly, appearing in the nucleus and cytoplasmic components.

Tissue specificity

Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.

Sequence similarities

Belongs to the IL-15/IL-21 family.

Sequence caution

The sequence CAA71044.1 differs from that shown. Reason: Man-made cDNA construct with a sequence coding for signal peptide increasing the secretion of the protein (substitution with a signal peptide derived from the mouse IgV kappa chain).

Ontologies

Keywords
   Cellular componentCytoplasm
Nucleus
Secreted
   Coding sequence diversityAlternative splicing
   DomainSignal
   Molecular functionCytokine
   PTMDisulfide bond
Glycoprotein
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processNK T cell proliferation

Inferred from electronic annotation. Source: Ensembl

aging

Inferred from electronic annotation. Source: Ensembl

cell maturation

Inferred from electronic annotation. Source: Ensembl

cell-cell signaling

Traceable author statement PubMed 7759105. Source: ProtInc

cellular response to vitamin D

Inferred from electronic annotation. Source: Ensembl

extrathymic T cell selection

Inferred from electronic annotation. Source: Ensembl

hyaluronan metabolic process

Inferred from electronic annotation. Source: Ensembl

immune response

Traceable author statement Ref.1. Source: ProtInc

inflammatory response

Inferred from electronic annotation. Source: Ensembl

lymph node development

Inferred from electronic annotation. Source: Ensembl

natural killer cell differentiation

Inferred from electronic annotation. Source: Ensembl

negative regulation of smooth muscle cell proliferation

Inferred from electronic annotation. Source: Ensembl

positive regulation of T cell proliferation

Inferred from electronic annotation. Source: Ensembl

positive regulation of cell proliferation

Traceable author statement PubMed 10851076. Source: ProtInc

positive regulation of immune response

Inferred from electronic annotation. Source: Ensembl

positive regulation of inflammatory response

Inferred by curator PubMed 16482511. Source: BHF-UCL

positive regulation of interleukin-17 production

Inferred from direct assay PubMed 16482511. Source: BHF-UCL

positive regulation of natural killer cell differentiation

Inferred from electronic annotation. Source: Ensembl

positive regulation of natural killer cell proliferation

Inferred from electronic annotation. Source: Ensembl

positive regulation of tissue remodeling

Inferred by curator PubMed 16482511. Source: BHF-UCL

positive regulation of tyrosine phosphorylation of Stat3 protein

Inferred from electronic annotation. Source: Ensembl

regulation of T cell differentiation

Inferred from electronic annotation. Source: Ensembl

regulation of defense response to virus by host

Inferred from electronic annotation. Source: Ensembl

signal transduction

Traceable author statement Ref.1. Source: ProtInc

skeletal muscle atrophy

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentGolgi apparatus

Traceable author statement PubMed 10851076. Source: ProtInc

cell surface

Inferred from electronic annotation. Source: Ensembl

cytoplasm

Inferred from direct assay. Source: HPA

endosome

Traceable author statement PubMed 10851076. Source: ProtInc

extracellular region

Non-traceable author statement PubMed 14718574. Source: UniProtKB

extracellular space

Traceable author statement PubMed 10851076. Source: ProtInc

integral component of plasma membrane

Traceable author statement PubMed 10851076. Source: ProtInc

membrane

Traceable author statement PubMed 10851076. Source: ProtInc

nucleus

Inferred from direct assay. Source: HPA

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

IL15RAQ132613EBI-980274,EBI-980354

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform IL15-S48AA (identifier: P40933-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform IL15-S21AA (identifier: P40933-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILG → MVLGTIDLCS

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2929 Potential
Propeptide30 – 4819 Potential
PRO_0000015393
Chain49 – 162114Interleukin-15
PRO_0000015394

Amino acid modifications

Glycosylation1271N-linked (GlcNAc...) Potential
Disulfide bond83 ↔ 133 By similarity
Disulfide bond90 ↔ 136 By similarity

Natural variations

Alternative sequence1 – 3737MRISK…VFILG → MVLGTIDLCS in isoform IL15-S21AA.
VSP_002660

Experimental info

Sequence conflict1411E → K in AAB97518. Ref.4

Secondary structure

............... 162
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform IL15-S48AA [UniParc].

Last modified February 1, 1995. Version 1.
Checksum: 0CE0520C1D8379E2

FASTA16218,086
        10         20         30         40         50         60 
MRISKPHLRS ISIQCYLCLL LNSHFLTEAG IHVFILGCFS AGLPKTEANW VNVISDLKKI 

        70         80         90        100        110        120 
EDLIQSMHID ATLYTESDVH PSCKVTAMKC FLLELQVISL ESGDASIHDT VENLIILANN 

       130        140        150        160 
SLSSNGNVTE SGCKECEELE EKNIKEFLQS FVHIVQMFIN TS 

« Hide

Isoform IL15-S21AA [UniParc].

Checksum: EB44F422096B143E
Show »

FASTA13514,912

References

« Hide 'large scale' references
[1]"Cloning of a T cell growth factor that interacts with the beta chain of the interleukin-2 receptor."
Grabstein K.H., Eisenman J., Shanebeck K., Rauch C., Srinivasan S., Fung V., Beers C., Richardson J., Schoenborn M.A., Ahdieh M., Johnson L., Alderson M.R., Watson J.D., Anderson D.M., Giri J.G.
Science 264:965-968(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S48AA).
Tissue: Bone marrow.
[2]"Genomic sequence and chromosomal location of the human interleukin-15 gene (IL15)."
Krause H., Jandrig B., Wernicke C., Bulfone-Paus S., Pohl T., Diamantstein T.
Cytokine 8:667-674(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[3]"Identification of a novel interleukin-15 (IL-15) transcript isoform generated by alternative splicing in human small cell lung cancer cell lines."
Meazza R., Verdiani S., Biassoni R., Coppolecchia M., Gaggero A., Orengo A.M., Colombo M.P., Azzarone B., Ferrini S.
Oncogene 12:2187-2192(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA).
Tissue: Lung cancer.
[4]"Generation of secretable and nonsecretable interleukin 15 isoforms through alternate usage of signal peptides."
Tagaya Y., Kurys G., Thies T.A., Losi J.M., Azimi N., Hanover J.A., Bamford R.N., Waldmann T.A.
Proc. Natl. Acad. Sci. U.S.A. 94:14444-14449(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA).
Tissue: Testis.
[5]"Expression of two IL-15 mRNA isoforms in human tumors does not correlate with secretion: role of different signal peptides."
Meazza R., Ferrini S.
Submitted (APR-1997) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM IL15-S48AA).
Tissue: Colon.
[8]"IL15 expression in human keratinocytes."
Sorel M.A., Jacques Y.
Submitted (OCT-1994) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 49-162.
Tissue: Epidermis.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U14407 mRNA. Translation: AAA21551.1.
X91233 Genomic DNA. Translation: CAA62616.1.
X94223 mRNA. Translation: CAA63914.1.
X94222 mRNA. Translation: CAA63913.1.
AF031167 mRNA. Translation: AAB97518.1.
Y09908 mRNA. Translation: CAA71044.1. Sequence problems.
CH471056 Genomic DNA. Translation: EAX05085.1.
CH471056 Genomic DNA. Translation: EAX05087.1.
BC018149 mRNA. Translation: AAH18149.1.
BC100963 mRNA. Translation: AAI00964.1.
Z38000 mRNA. Translation: CAA86100.1.
RefSeqNP_000576.1. NM_000585.4.
NP_751915.1. NM_172175.2.
UniGeneHs.168132.
Hs.602618.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2XQBX-ray2.60A49-162[»]
2Z3QX-ray1.85A/C49-162[»]
2Z3RX-ray2.00A/C/E/G/I/K/M/O49-162[»]
4GS7X-ray2.35A49-162[»]
ProteinModelPortalP40933.
SMRP40933. Positions 48-162.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid109813. 4 interactions.
DIPDIP-3046N.
IntActP40933. 1 interaction.
STRING9606.ENSP00000296545.

PTM databases

PhosphoSiteP40933.

Proteomic databases

PRIDEP40933.

Protocols and materials databases

DNASU3600.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000296545; ENSP00000296545; ENSG00000164136. [P40933-1]
ENST00000320650; ENSP00000323505; ENSG00000164136. [P40933-1]
ENST00000394159; ENSP00000377714; ENSG00000164136. [P40933-2]
ENST00000477265; ENSP00000436914; ENSG00000164136. [P40933-2]
ENST00000514653; ENSP00000422271; ENSG00000164136. [P40933-2]
ENST00000529613; ENSP00000435462; ENSG00000164136. [P40933-1]
GeneID3600.
KEGGhsa:3600.
UCSCuc003iis.3. human. [P40933-1]

Organism-specific databases

CTD3600.
GeneCardsGC04P142557.
HGNCHGNC:5977. IL15.
HPACAB004457.
HPA037738.
MIM600554. gene.
neXtProtNX_P40933.
PharmGKBPA29790.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG44071.
HOVERGENHBG006142.
InParanoidP40933.
KOK05433.
OMARSTSIQC.
OrthoDBEOG77Q4ZF.
PhylomeDBP40933.
TreeFamTF336199.

Enzyme and pathway databases

SignaLinkP40933.

Gene expression databases

ArrayExpressP40933.
BgeeP40933.
CleanExHS_IL15.
GenevestigatorP40933.

Family and domain databases

InterProIPR009079. 4_helix_cytokine-like_core.
IPR020439. IL-15.
IPR003443. IL-15/IL-21_fam.
IPR020466. IL-15_mml.
[Graphical view]
PfamPF02372. IL15. 1 hit.
[Graphical view]
PRINTSPR01947. INTLKN15MAML.
PR01930. INTRLEUKIN15.
SUPFAMSSF47266. SSF47266. 1 hit.
ProtoNetSearch...

Other

EvolutionaryTraceP40933.
GeneWikiInterleukin_15.
GenomeRNAi3600.
NextBio14065.
PROP40933.
SOURCESearch...

Entry information

Entry nameIL15_HUMAN
AccessionPrimary (citable) accession number: P40933
Secondary accession number(s): D3DNZ2 expand/collapse secondary AC list , O00440, O43512, Q495Z8, Q93058, Q9UBA3
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: April 16, 2014
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM