Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P40933

- IL15_HUMAN

UniProt

P40933 - IL15_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Interleukin-15

Gene

IL15

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

GO - Biological processi

  1. aging Source: Ensembl
  2. cell-cell signaling Source: ProtInc
  3. cell maturation Source: Ensembl
  4. cellular response to vitamin D Source: Ensembl
  5. extrathymic T cell selection Source: Ensembl
  6. hyaluronan metabolic process Source: Ensembl
  7. immune response Source: ProtInc
  8. inflammatory response Source: Ensembl
  9. lymph node development Source: Ensembl
  10. natural killer cell differentiation Source: Ensembl
  11. negative regulation of smooth muscle cell proliferation Source: Ensembl
  12. NK T cell proliferation Source: Ensembl
  13. positive regulation of cell proliferation Source: ProtInc
  14. positive regulation of immune response Source: Ensembl
  15. positive regulation of inflammatory response Source: BHF-UCL
  16. positive regulation of interleukin-17 production Source: BHF-UCL
  17. positive regulation of natural killer cell differentiation Source: Ensembl
  18. positive regulation of natural killer cell proliferation Source: Ensembl
  19. positive regulation of T cell proliferation Source: Ensembl
  20. positive regulation of tissue remodeling Source: BHF-UCL
  21. positive regulation of tyrosine phosphorylation of Stat3 protein Source: Ensembl
  22. regulation of defense response to virus by host Source: Ensembl
  23. regulation of T cell differentiation Source: Ensembl
  24. signal transduction Source: ProtInc
  25. skeletal muscle atrophy Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Cytokine

Enzyme and pathway databases

SignaLinkiP40933.

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-15
Short name:
IL-15
Gene namesi
Name:IL15
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:5977. IL15.

Subcellular locationi

Isoform IL15-S21AA : Cytoplasm. Nucleus
Note: IL15-S21AA is not secreted, but rather is stored intracellularly, appearing in the nucleus and cytoplasmic components.

GO - Cellular componenti

  1. cell surface Source: Ensembl
  2. cytoplasm Source: HPA
  3. endosome Source: ProtInc
  4. extracellular region Source: UniProtKB
  5. extracellular space Source: ProtInc
  6. Golgi apparatus Source: ProtInc
  7. integral component of plasma membrane Source: ProtInc
  8. membrane Source: ProtInc
  9. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA29790.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929Sequence AnalysisAdd
BLAST
Propeptidei30 – 4819Sequence AnalysisPRO_0000015393Add
BLAST
Chaini49 – 162114Interleukin-15PRO_0000015394Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi83 ↔ 1331 Publication
Disulfide bondi90 ↔ 1361 Publication
Glycosylationi127 – 1271N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiP40933.

PTM databases

PhosphoSiteiP40933.

Expressioni

Tissue specificityi

Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.

Gene expression databases

BgeeiP40933.
CleanExiHS_IL15.
GenevestigatoriP40933.

Organism-specific databases

HPAiCAB004457.
HPA037738.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
IL15RAQ132613EBI-980274,EBI-980354

Protein-protein interaction databases

BioGridi109813. 4 interactions.
DIPiDIP-3046N.
IntActiP40933. 4 interactions.
STRINGi9606.ENSP00000296545.

Structurei

Secondary structure

1
162
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi49 – 6416
Beta strandi73 – 753
Helixi81 – 833
Helixi84 – 10219
Helixi105 – 11915
Helixi136 – 1383
Beta strandi139 – 1424
Helixi144 – 15815

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2XQBX-ray2.60A49-162[»]
2Z3QX-ray1.85A/C49-162[»]
2Z3RX-ray2.00A/C/E/G/I/K/M/O49-162[»]
4GS7X-ray2.35A49-162[»]
ProteinModelPortaliP40933.
SMRiP40933. Positions 48-162.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP40933.

Family & Domainsi

Sequence similaritiesi

Belongs to the IL-15/IL-21 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG44071.
GeneTreeiENSGT00390000016264.
HOVERGENiHBG006142.
InParanoidiP40933.
KOiK05433.
OMAiRSTSIQC.
OrthoDBiEOG77Q4ZF.
PhylomeDBiP40933.
TreeFamiTF336199.

Family and domain databases

InterProiIPR009079. 4_helix_cytokine-like_core.
IPR020439. IL-15.
IPR003443. IL-15/IL-21_fam.
IPR020466. IL-15_mml.
[Graphical view]
PfamiPF02372. IL15. 1 hit.
[Graphical view]
PRINTSiPR01947. INTLKN15MAML.
PR01930. INTRLEUKIN15.
SUPFAMiSSF47266. SSF47266. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform IL15-S48AA (identifier: P40933-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRISKPHLRS ISIQCYLCLL LNSHFLTEAG IHVFILGCFS AGLPKTEANW
60 70 80 90 100
VNVISDLKKI EDLIQSMHID ATLYTESDVH PSCKVTAMKC FLLELQVISL
110 120 130 140 150
ESGDASIHDT VENLIILANN SLSSNGNVTE SGCKECEELE EKNIKEFLQS
160
FVHIVQMFIN TS
Length:162
Mass (Da):18,086
Last modified:February 1, 1995 - v1
Checksum:i0CE0520C1D8379E2
GO
Isoform IL15-S21AA (identifier: P40933-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILG → MVLGTIDLCS

Show »
Length:135
Mass (Da):14,912
Checksum:iEB44F422096B143E
GO

Sequence cautioni

The sequence CAA71044.1 differs from that shown. Reason: Man-made cDNA with a signal peptide sequence to increase protein secretion (substitution with a signal peptide derived from the mouse IgV kappa chain).

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti141 – 1411E → K in AAB97518. (PubMed:9405632)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3737MRISK…VFILG → MVLGTIDLCS in isoform IL15-S21AA. 6 PublicationsVSP_002660Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U14407 mRNA. Translation: AAA21551.1.
X91233 Genomic DNA. Translation: CAA62616.1.
X94223 mRNA. Translation: CAA63914.1.
X94222 mRNA. Translation: CAA63913.1.
AF031167 mRNA. Translation: AAB97518.1.
Y09908 mRNA. Translation: CAA71044.1. Sequence problems.
AY720442 mRNA. Translation: AAU21241.1.
AK122993 mRNA. Translation: BAG53839.1.
AK290619 mRNA. Translation: BAF83308.1.
CR541980 mRNA. Translation: CAG46777.1.
CR542007 mRNA. Translation: CAG46804.1.
CH471056 Genomic DNA. Translation: EAX05083.1.
CH471056 Genomic DNA. Translation: EAX05084.1.
CH471056 Genomic DNA. Translation: EAX05085.1.
CH471056 Genomic DNA. Translation: EAX05086.1.
CH471056 Genomic DNA. Translation: EAX05087.1.
BC018149 mRNA. Translation: AAH18149.1.
BC100961 mRNA. Translation: AAI00962.1.
BC100962 mRNA. Translation: AAI00963.1.
BC100963 mRNA. Translation: AAI00964.1.
Z38000 mRNA. Translation: CAA86100.1.
CCDSiCCDS3755.1. [P40933-1]
CCDS3756.1. [P40933-2]
RefSeqiNP_000576.1. NM_000585.4. [P40933-1]
NP_751915.1. NM_172175.2. [P40933-2]
UniGeneiHs.168132.
Hs.602618.

Genome annotation databases

EnsembliENST00000296545; ENSP00000296545; ENSG00000164136. [P40933-1]
ENST00000320650; ENSP00000323505; ENSG00000164136. [P40933-1]
ENST00000394159; ENSP00000377714; ENSG00000164136. [P40933-2]
ENST00000477265; ENSP00000436914; ENSG00000164136. [P40933-2]
ENST00000514653; ENSP00000422271; ENSG00000164136. [P40933-2]
ENST00000529613; ENSP00000435462; ENSG00000164136. [P40933-1]
GeneIDi3600.
KEGGihsa:3600.
UCSCiuc003iis.3. human. [P40933-1]
uc010iol.3. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

R&D Systems' cytokine source book: IL-15
Wikipedia

Interleukin-15 entry

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U14407 mRNA. Translation: AAA21551.1 .
X91233 Genomic DNA. Translation: CAA62616.1 .
X94223 mRNA. Translation: CAA63914.1 .
X94222 mRNA. Translation: CAA63913.1 .
AF031167 mRNA. Translation: AAB97518.1 .
Y09908 mRNA. Translation: CAA71044.1 . Sequence problems.
AY720442 mRNA. Translation: AAU21241.1 .
AK122993 mRNA. Translation: BAG53839.1 .
AK290619 mRNA. Translation: BAF83308.1 .
CR541980 mRNA. Translation: CAG46777.1 .
CR542007 mRNA. Translation: CAG46804.1 .
CH471056 Genomic DNA. Translation: EAX05083.1 .
CH471056 Genomic DNA. Translation: EAX05084.1 .
CH471056 Genomic DNA. Translation: EAX05085.1 .
CH471056 Genomic DNA. Translation: EAX05086.1 .
CH471056 Genomic DNA. Translation: EAX05087.1 .
BC018149 mRNA. Translation: AAH18149.1 .
BC100961 mRNA. Translation: AAI00962.1 .
BC100962 mRNA. Translation: AAI00963.1 .
BC100963 mRNA. Translation: AAI00964.1 .
Z38000 mRNA. Translation: CAA86100.1 .
CCDSi CCDS3755.1. [P40933-1 ]
CCDS3756.1. [P40933-2 ]
RefSeqi NP_000576.1. NM_000585.4. [P40933-1 ]
NP_751915.1. NM_172175.2. [P40933-2 ]
UniGenei Hs.168132.
Hs.602618.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2XQB X-ray 2.60 A 49-162 [» ]
2Z3Q X-ray 1.85 A/C 49-162 [» ]
2Z3R X-ray 2.00 A/C/E/G/I/K/M/O 49-162 [» ]
4GS7 X-ray 2.35 A 49-162 [» ]
ProteinModelPortali P40933.
SMRi P40933. Positions 48-162.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109813. 4 interactions.
DIPi DIP-3046N.
IntActi P40933. 4 interactions.
STRINGi 9606.ENSP00000296545.

PTM databases

PhosphoSitei P40933.

Proteomic databases

PRIDEi P40933.

Protocols and materials databases

DNASUi 3600.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000296545 ; ENSP00000296545 ; ENSG00000164136 . [P40933-1 ]
ENST00000320650 ; ENSP00000323505 ; ENSG00000164136 . [P40933-1 ]
ENST00000394159 ; ENSP00000377714 ; ENSG00000164136 . [P40933-2 ]
ENST00000477265 ; ENSP00000436914 ; ENSG00000164136 . [P40933-2 ]
ENST00000514653 ; ENSP00000422271 ; ENSG00000164136 . [P40933-2 ]
ENST00000529613 ; ENSP00000435462 ; ENSG00000164136 . [P40933-1 ]
GeneIDi 3600.
KEGGi hsa:3600.
UCSCi uc003iis.3. human. [P40933-1 ]
uc010iol.3. human.

Organism-specific databases

CTDi 3600.
GeneCardsi GC04P142557.
HGNCi HGNC:5977. IL15.
HPAi CAB004457.
HPA037738.
MIMi 600554. gene.
neXtProti NX_P40933.
PharmGKBi PA29790.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG44071.
GeneTreei ENSGT00390000016264.
HOVERGENi HBG006142.
InParanoidi P40933.
KOi K05433.
OMAi RSTSIQC.
OrthoDBi EOG77Q4ZF.
PhylomeDBi P40933.
TreeFami TF336199.

Enzyme and pathway databases

SignaLinki P40933.

Miscellaneous databases

EvolutionaryTracei P40933.
GeneWikii Interleukin_15.
GenomeRNAii 3600.
NextBioi 14065.
PROi P40933.
SOURCEi Search...

Gene expression databases

Bgeei P40933.
CleanExi HS_IL15.
Genevestigatori P40933.

Family and domain databases

InterProi IPR009079. 4_helix_cytokine-like_core.
IPR020439. IL-15.
IPR003443. IL-15/IL-21_fam.
IPR020466. IL-15_mml.
[Graphical view ]
Pfami PF02372. IL15. 1 hit.
[Graphical view ]
PRINTSi PR01947. INTLKN15MAML.
PR01930. INTRLEUKIN15.
SUPFAMi SSF47266. SSF47266. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S48AA).
    Tissue: Bone marrow.
  2. "Genomic sequence and chromosomal location of the human interleukin-15 gene (IL15)."
    Krause H., Jandrig B., Wernicke C., Bulfone-Paus S., Pohl T., Diamantstein T.
    Cytokine 8:667-674(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. "Identification of a novel interleukin-15 (IL-15) transcript isoform generated by alternative splicing in human small cell lung cancer cell lines."
    Meazza R., Verdiani S., Biassoni R., Coppolecchia M., Gaggero A., Orengo A.M., Colombo M.P., Azzarone B., Ferrini S.
    Oncogene 12:2187-2192(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA).
    Tissue: Lung cancer.
  4. "Generation of secretable and nonsecretable interleukin 15 isoforms through alternate usage of signal peptides."
    Tagaya Y., Kurys G., Thies T.A., Losi J.M., Azimi N., Hanover J.A., Bamford R.N., Waldmann T.A.
    Proc. Natl. Acad. Sci. U.S.A. 94:14444-14449(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA).
    Tissue: Testis.
  5. "Expression of two IL-15 mRNA isoforms in human tumors does not correlate with secretion: role of different signal peptides."
    Meazza R., Ferrini S.
    Submitted (APR-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
  6. Li C.
    Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA).
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM IL15-S21AA).
    Tissue: Cerebellum and Heart.
  8. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM IL15-S21AA).
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS IL15-S48AA AND IL15-S21AA).
    Tissue: Colon.
  11. "IL15 expression in human keratinocytes."
    Sorel M.A., Jacques Y.
    Submitted (OCT-1994) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 49-162.
    Tissue: Epidermis.
  12. "Engineering a high-affinity anti-IL-15 antibody: crystal structure reveals an alpha-helix in VH CDR3 as key component of paratope."
    Lowe D.C., Gerhardt S., Ward A., Hargreaves D., Anderson M., Ferraro F., Pauptit R.A., Pattison D.V., Buchanan C., Popovic B., Finch D.K., Wilkinson T., Sleeman M., Vaughan T.J., Mallinder P.R.
    J. Mol. Biol. 406:160-175(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 49-162 IN COMPLEX WITH ANTIBODY, DISULFIDE BONDS.

Entry informationi

Entry nameiIL15_HUMAN
AccessioniPrimary (citable) accession number: P40933
Secondary accession number(s): D3DNZ2
, O00440, O43512, Q495Z8, Q6FGX7, Q93058, Q9UBA3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: October 29, 2014
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3