Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P40933

- IL15_HUMAN

UniProt

P40933 - IL15_HUMAN

Protein

Interleukin-15

Gene

IL15

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. aging Source: Ensembl
    2. cell-cell signaling Source: ProtInc
    3. cell maturation Source: Ensembl
    4. cellular response to vitamin D Source: Ensembl
    5. extrathymic T cell selection Source: Ensembl
    6. hyaluronan metabolic process Source: Ensembl
    7. immune response Source: ProtInc
    8. inflammatory response Source: Ensembl
    9. lymph node development Source: Ensembl
    10. natural killer cell differentiation Source: Ensembl
    11. negative regulation of smooth muscle cell proliferation Source: Ensembl
    12. NK T cell proliferation Source: Ensembl
    13. positive regulation of cell proliferation Source: ProtInc
    14. positive regulation of immune response Source: Ensembl
    15. positive regulation of inflammatory response Source: BHF-UCL
    16. positive regulation of interleukin-17 production Source: BHF-UCL
    17. positive regulation of natural killer cell differentiation Source: Ensembl
    18. positive regulation of natural killer cell proliferation Source: Ensembl
    19. positive regulation of T cell proliferation Source: Ensembl
    20. positive regulation of tissue remodeling Source: BHF-UCL
    21. positive regulation of tyrosine phosphorylation of Stat3 protein Source: Ensembl
    22. regulation of defense response to virus by host Source: Ensembl
    23. regulation of T cell differentiation Source: Ensembl
    24. signal transduction Source: ProtInc
    25. skeletal muscle atrophy Source: Ensembl

    Keywords - Molecular functioni

    Cytokine

    Enzyme and pathway databases

    SignaLinkiP40933.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Interleukin-15
    Short name:
    IL-15
    Gene namesi
    Name:IL15
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:5977. IL15.

    Subcellular locationi

    Isoform IL15-S21AA : Cytoplasm. Nucleus
    Note: IL15-S21AA is not secreted, but rather is stored intracellularly, appearing in the nucleus and cytoplasmic components.

    GO - Cellular componenti

    1. cell surface Source: Ensembl
    2. cytoplasm Source: HPA
    3. endosome Source: ProtInc
    4. extracellular region Source: UniProtKB
    5. extracellular space Source: ProtInc
    6. Golgi apparatus Source: ProtInc
    7. integral component of plasma membrane Source: ProtInc
    8. membrane Source: ProtInc
    9. nucleus Source: HPA

    Keywords - Cellular componenti

    Cytoplasm, Nucleus, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA29790.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2929Sequence AnalysisAdd
    BLAST
    Propeptidei30 – 4819Sequence AnalysisPRO_0000015393Add
    BLAST
    Chaini49 – 162114Interleukin-15PRO_0000015394Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi83 ↔ 1331 Publication
    Disulfide bondi90 ↔ 1361 Publication
    Glycosylationi127 – 1271N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PRIDEiP40933.

    PTM databases

    PhosphoSiteiP40933.

    Expressioni

    Tissue specificityi

    Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.

    Gene expression databases

    ArrayExpressiP40933.
    BgeeiP40933.
    CleanExiHS_IL15.
    GenevestigatoriP40933.

    Organism-specific databases

    HPAiCAB004457.
    HPA037738.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    IL15RAQ132613EBI-980274,EBI-980354

    Protein-protein interaction databases

    BioGridi109813. 4 interactions.
    DIPiDIP-3046N.
    IntActiP40933. 4 interactions.
    STRINGi9606.ENSP00000296545.

    Structurei

    Secondary structure

    1
    162
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi49 – 6416
    Beta strandi73 – 753
    Helixi81 – 833
    Helixi84 – 10219
    Helixi105 – 11915
    Helixi136 – 1383
    Beta strandi139 – 1424
    Helixi144 – 15815

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2XQBX-ray2.60A49-162[»]
    2Z3QX-ray1.85A/C49-162[»]
    2Z3RX-ray2.00A/C/E/G/I/K/M/O49-162[»]
    4GS7X-ray2.35A49-162[»]
    ProteinModelPortaliP40933.
    SMRiP40933. Positions 48-162.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP40933.

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the IL-15/IL-21 family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG44071.
    HOVERGENiHBG006142.
    InParanoidiP40933.
    KOiK05433.
    OMAiRSTSIQC.
    OrthoDBiEOG77Q4ZF.
    PhylomeDBiP40933.
    TreeFamiTF336199.

    Family and domain databases

    InterProiIPR009079. 4_helix_cytokine-like_core.
    IPR020439. IL-15.
    IPR003443. IL-15/IL-21_fam.
    IPR020466. IL-15_mml.
    [Graphical view]
    PfamiPF02372. IL15. 1 hit.
    [Graphical view]
    PRINTSiPR01947. INTLKN15MAML.
    PR01930. INTRLEUKIN15.
    SUPFAMiSSF47266. SSF47266. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform IL15-S48AA (identifier: P40933-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRISKPHLRS ISIQCYLCLL LNSHFLTEAG IHVFILGCFS AGLPKTEANW    50
    VNVISDLKKI EDLIQSMHID ATLYTESDVH PSCKVTAMKC FLLELQVISL 100
    ESGDASIHDT VENLIILANN SLSSNGNVTE SGCKECEELE EKNIKEFLQS 150
    FVHIVQMFIN TS 162
    Length:162
    Mass (Da):18,086
    Last modified:February 1, 1995 - v1
    Checksum:i0CE0520C1D8379E2
    GO
    Isoform IL15-S21AA (identifier: P40933-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-37: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILG → MVLGTIDLCS

    Show »
    Length:135
    Mass (Da):14,912
    Checksum:iEB44F422096B143E
    GO

    Sequence cautioni

    The sequence CAA71044.1 differs from that shown. Reason: Man-made cDNA with a signal peptide sequence to increase protein secretion (substitution with a signal peptide derived from the mouse IgV kappa chain).

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti141 – 1411E → K in AAB97518. (PubMed:9405632)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3737MRISK…VFILG → MVLGTIDLCS in isoform IL15-S21AA. 6 PublicationsVSP_002660Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U14407 mRNA. Translation: AAA21551.1.
    X91233 Genomic DNA. Translation: CAA62616.1.
    X94223 mRNA. Translation: CAA63914.1.
    X94222 mRNA. Translation: CAA63913.1.
    AF031167 mRNA. Translation: AAB97518.1.
    Y09908 mRNA. Translation: CAA71044.1. Sequence problems.
    AY720442 mRNA. Translation: AAU21241.1.
    AK122993 mRNA. Translation: BAG53839.1.
    AK290619 mRNA. Translation: BAF83308.1.
    CR541980 mRNA. Translation: CAG46777.1.
    CR542007 mRNA. Translation: CAG46804.1.
    CH471056 Genomic DNA. Translation: EAX05083.1.
    CH471056 Genomic DNA. Translation: EAX05084.1.
    CH471056 Genomic DNA. Translation: EAX05085.1.
    CH471056 Genomic DNA. Translation: EAX05086.1.
    CH471056 Genomic DNA. Translation: EAX05087.1.
    BC018149 mRNA. Translation: AAH18149.1.
    BC100961 mRNA. Translation: AAI00962.1.
    BC100962 mRNA. Translation: AAI00963.1.
    BC100963 mRNA. Translation: AAI00964.1.
    Z38000 mRNA. Translation: CAA86100.1.
    CCDSiCCDS3755.1. [P40933-1]
    CCDS3756.1. [P40933-2]
    RefSeqiNP_000576.1. NM_000585.4. [P40933-1]
    NP_751915.1. NM_172175.2. [P40933-2]
    UniGeneiHs.168132.
    Hs.602618.

    Genome annotation databases

    EnsembliENST00000296545; ENSP00000296545; ENSG00000164136. [P40933-1]
    ENST00000320650; ENSP00000323505; ENSG00000164136. [P40933-1]
    ENST00000394159; ENSP00000377714; ENSG00000164136. [P40933-2]
    ENST00000477265; ENSP00000436914; ENSG00000164136. [P40933-2]
    ENST00000514653; ENSP00000422271; ENSG00000164136. [P40933-2]
    ENST00000529613; ENSP00000435462; ENSG00000164136. [P40933-1]
    GeneIDi3600.
    KEGGihsa:3600.
    UCSCiuc003iis.3. human. [P40933-1]
    uc010iol.3. human.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    R&D Systems' cytokine source book: IL-15
    Wikipedia

    Interleukin-15 entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U14407 mRNA. Translation: AAA21551.1 .
    X91233 Genomic DNA. Translation: CAA62616.1 .
    X94223 mRNA. Translation: CAA63914.1 .
    X94222 mRNA. Translation: CAA63913.1 .
    AF031167 mRNA. Translation: AAB97518.1 .
    Y09908 mRNA. Translation: CAA71044.1 . Sequence problems.
    AY720442 mRNA. Translation: AAU21241.1 .
    AK122993 mRNA. Translation: BAG53839.1 .
    AK290619 mRNA. Translation: BAF83308.1 .
    CR541980 mRNA. Translation: CAG46777.1 .
    CR542007 mRNA. Translation: CAG46804.1 .
    CH471056 Genomic DNA. Translation: EAX05083.1 .
    CH471056 Genomic DNA. Translation: EAX05084.1 .
    CH471056 Genomic DNA. Translation: EAX05085.1 .
    CH471056 Genomic DNA. Translation: EAX05086.1 .
    CH471056 Genomic DNA. Translation: EAX05087.1 .
    BC018149 mRNA. Translation: AAH18149.1 .
    BC100961 mRNA. Translation: AAI00962.1 .
    BC100962 mRNA. Translation: AAI00963.1 .
    BC100963 mRNA. Translation: AAI00964.1 .
    Z38000 mRNA. Translation: CAA86100.1 .
    CCDSi CCDS3755.1. [P40933-1 ]
    CCDS3756.1. [P40933-2 ]
    RefSeqi NP_000576.1. NM_000585.4. [P40933-1 ]
    NP_751915.1. NM_172175.2. [P40933-2 ]
    UniGenei Hs.168132.
    Hs.602618.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2XQB X-ray 2.60 A 49-162 [» ]
    2Z3Q X-ray 1.85 A/C 49-162 [» ]
    2Z3R X-ray 2.00 A/C/E/G/I/K/M/O 49-162 [» ]
    4GS7 X-ray 2.35 A 49-162 [» ]
    ProteinModelPortali P40933.
    SMRi P40933. Positions 48-162.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 109813. 4 interactions.
    DIPi DIP-3046N.
    IntActi P40933. 4 interactions.
    STRINGi 9606.ENSP00000296545.

    PTM databases

    PhosphoSitei P40933.

    Proteomic databases

    PRIDEi P40933.

    Protocols and materials databases

    DNASUi 3600.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000296545 ; ENSP00000296545 ; ENSG00000164136 . [P40933-1 ]
    ENST00000320650 ; ENSP00000323505 ; ENSG00000164136 . [P40933-1 ]
    ENST00000394159 ; ENSP00000377714 ; ENSG00000164136 . [P40933-2 ]
    ENST00000477265 ; ENSP00000436914 ; ENSG00000164136 . [P40933-2 ]
    ENST00000514653 ; ENSP00000422271 ; ENSG00000164136 . [P40933-2 ]
    ENST00000529613 ; ENSP00000435462 ; ENSG00000164136 . [P40933-1 ]
    GeneIDi 3600.
    KEGGi hsa:3600.
    UCSCi uc003iis.3. human. [P40933-1 ]
    uc010iol.3. human.

    Organism-specific databases

    CTDi 3600.
    GeneCardsi GC04P142557.
    HGNCi HGNC:5977. IL15.
    HPAi CAB004457.
    HPA037738.
    MIMi 600554. gene.
    neXtProti NX_P40933.
    PharmGKBi PA29790.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG44071.
    HOVERGENi HBG006142.
    InParanoidi P40933.
    KOi K05433.
    OMAi RSTSIQC.
    OrthoDBi EOG77Q4ZF.
    PhylomeDBi P40933.
    TreeFami TF336199.

    Enzyme and pathway databases

    SignaLinki P40933.

    Miscellaneous databases

    EvolutionaryTracei P40933.
    GeneWikii Interleukin_15.
    GenomeRNAii 3600.
    NextBioi 14065.
    PROi P40933.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P40933.
    Bgeei P40933.
    CleanExi HS_IL15.
    Genevestigatori P40933.

    Family and domain databases

    InterProi IPR009079. 4_helix_cytokine-like_core.
    IPR020439. IL-15.
    IPR003443. IL-15/IL-21_fam.
    IPR020466. IL-15_mml.
    [Graphical view ]
    Pfami PF02372. IL15. 1 hit.
    [Graphical view ]
    PRINTSi PR01947. INTLKN15MAML.
    PR01930. INTRLEUKIN15.
    SUPFAMi SSF47266. SSF47266. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S48AA).
      Tissue: Bone marrow.
    2. "Genomic sequence and chromosomal location of the human interleukin-15 gene (IL15)."
      Krause H., Jandrig B., Wernicke C., Bulfone-Paus S., Pohl T., Diamantstein T.
      Cytokine 8:667-674(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. "Identification of a novel interleukin-15 (IL-15) transcript isoform generated by alternative splicing in human small cell lung cancer cell lines."
      Meazza R., Verdiani S., Biassoni R., Coppolecchia M., Gaggero A., Orengo A.M., Colombo M.P., Azzarone B., Ferrini S.
      Oncogene 12:2187-2192(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA).
      Tissue: Lung cancer.
    4. "Generation of secretable and nonsecretable interleukin 15 isoforms through alternate usage of signal peptides."
      Tagaya Y., Kurys G., Thies T.A., Losi J.M., Azimi N., Hanover J.A., Bamford R.N., Waldmann T.A.
      Proc. Natl. Acad. Sci. U.S.A. 94:14444-14449(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA).
      Tissue: Testis.
    5. "Expression of two IL-15 mRNA isoforms in human tumors does not correlate with secretion: role of different signal peptides."
      Meazza R., Ferrini S.
      Submitted (APR-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    6. Li C.
      Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA).
    7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM IL15-S21AA).
      Tissue: Cerebellum and Heart.
    8. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM IL15-S21AA).
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS IL15-S48AA AND IL15-S21AA).
      Tissue: Colon.
    11. "IL15 expression in human keratinocytes."
      Sorel M.A., Jacques Y.
      Submitted (OCT-1994) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 49-162.
      Tissue: Epidermis.
    12. "Engineering a high-affinity anti-IL-15 antibody: crystal structure reveals an alpha-helix in VH CDR3 as key component of paratope."
      Lowe D.C., Gerhardt S., Ward A., Hargreaves D., Anderson M., Ferraro F., Pauptit R.A., Pattison D.V., Buchanan C., Popovic B., Finch D.K., Wilkinson T., Sleeman M., Vaughan T.J., Mallinder P.R.
      J. Mol. Biol. 406:160-175(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 49-162 IN COMPLEX WITH ANTIBODY, DISULFIDE BONDS.

    Entry informationi

    Entry nameiIL15_HUMAN
    AccessioniPrimary (citable) accession number: P40933
    Secondary accession number(s): D3DNZ2
    , O00440, O43512, Q495Z8, Q6FGX7, Q93058, Q9UBA3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1995
    Last sequence update: February 1, 1995
    Last modified: October 1, 2014
    This is version 133 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3