Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interleukin-15

Gene

IL15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionCytokine

Enzyme and pathway databases

ReactomeiR-HSA-8983432. Interleukin-15 signaling.
SignaLinkiP40933.
SIGNORiP40933.

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-15
Short name:
IL-15
Gene namesi
Name:IL15
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000164136.16.
HGNCiHGNC:5977. IL15.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi3600.
OpenTargetsiENSG00000164136.
PharmGKBiPA29790.

Chemistry databases

ChEMBLiCHEMBL3712954.

Polymorphism and mutation databases

BioMutaiIL15.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
PropeptideiPRO_000001539330 – 48Sequence analysisAdd BLAST19
ChainiPRO_000001539449 – 162Interleukin-15Add BLAST114

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi83 ↔ 1331 Publication
Disulfide bondi90 ↔ 1361 Publication
Glycosylationi127N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP40933.
PeptideAtlasiP40933.
PRIDEiP40933.

PTM databases

iPTMnetiP40933.
PhosphoSitePlusiP40933.

Expressioni

Tissue specificityi

Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.

Gene expression databases

BgeeiENSG00000164136.
CleanExiHS_IL15.
GenevisibleiP40933. HS.

Organism-specific databases

HPAiCAB004457.
HPA037738.

Interactioni

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi109813. 10 interactors.
DIPiDIP-3046N.
IntActiP40933. 5 interactors.
STRINGi9606.ENSP00000296545.

Structurei

Secondary structure

1162
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi49 – 64Combined sources16
Beta strandi73 – 75Combined sources3
Helixi81 – 83Combined sources3
Helixi84 – 102Combined sources19
Helixi105 – 119Combined sources15
Helixi136 – 138Combined sources3
Beta strandi139 – 142Combined sources4
Helixi144 – 158Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2XQBX-ray2.60A49-162[»]
2Z3QX-ray1.85A/C49-162[»]
2Z3RX-ray2.00A/C/E/G/I/K/M/O49-162[»]
4GS7X-ray2.35A49-162[»]
ProteinModelPortaliP40933.
SMRiP40933.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP40933.

Family & Domainsi

Sequence similaritiesi

Belongs to the IL-15/IL-21 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IZ5D. Eukaryota.
ENOG41119SX. LUCA.
GeneTreeiENSGT00390000016264.
HOGENOMiHOG000113029.
HOVERGENiHBG006142.
InParanoidiP40933.
KOiK05433.
OMAiTSIQCYL.
OrthoDBiEOG091G0VGG.
PhylomeDBiP40933.
TreeFamiTF336199.

Family and domain databases

InterProiView protein in InterPro
IPR009079. 4_helix_cytokine-like_core.
IPR020439. IL-15.
IPR003443. IL-15/IL-21_fam.
IPR020466. IL-15_mml.
PfamiView protein in Pfam
PF02372. IL15. 1 hit.
PRINTSiPR01947. INTLKN15MAML.
PR01930. INTRLEUKIN15.
SUPFAMiSSF47266. SSF47266. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform IL15-S48AA (identifier: P40933-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRISKPHLRS ISIQCYLCLL LNSHFLTEAG IHVFILGCFS AGLPKTEANW
60 70 80 90 100
VNVISDLKKI EDLIQSMHID ATLYTESDVH PSCKVTAMKC FLLELQVISL
110 120 130 140 150
ESGDASIHDT VENLIILANN SLSSNGNVTE SGCKECEELE EKNIKEFLQS
160
FVHIVQMFIN TS
Length:162
Mass (Da):18,086
Last modified:February 1, 1995 - v1
Checksum:i0CE0520C1D8379E2
GO
Isoform IL15-S21AA (identifier: P40933-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILG → MVLGTIDLCS

Show »
Length:135
Mass (Da):14,912
Checksum:iEB44F422096B143E
GO

Sequence cautioni

The sequence CAA71044 differs from that shown. Man-made cDNA with a signal peptide sequence to increase protein secretion (substitution with a signal peptide derived from the mouse IgV kappa chain).Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti141E → K in AAB97518 (PubMed:9405632).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0026601 – 37MRISK…VFILG → MVLGTIDLCS in isoform IL15-S21AA. 6 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U14407 mRNA. Translation: AAA21551.1.
X91233 Genomic DNA. Translation: CAA62616.1.
X94223 mRNA. Translation: CAA63914.1.
X94222 mRNA. Translation: CAA63913.1.
AF031167 mRNA. Translation: AAB97518.1.
Y09908 mRNA. Translation: CAA71044.1. Sequence problems.
AY720442 mRNA. Translation: AAU21241.1.
AK122993 mRNA. Translation: BAG53839.1.
AK290619 mRNA. Translation: BAF83308.1.
CR541980 mRNA. Translation: CAG46777.1.
CR542007 mRNA. Translation: CAG46804.1.
CH471056 Genomic DNA. Translation: EAX05083.1.
CH471056 Genomic DNA. Translation: EAX05084.1.
CH471056 Genomic DNA. Translation: EAX05085.1.
CH471056 Genomic DNA. Translation: EAX05086.1.
CH471056 Genomic DNA. Translation: EAX05087.1.
BC018149 mRNA. Translation: AAH18149.1.
BC100961 mRNA. Translation: AAI00962.1.
BC100962 mRNA. Translation: AAI00963.1.
BC100963 mRNA. Translation: AAI00964.1.
Z38000 mRNA. Translation: CAA86100.1.
CCDSiCCDS3755.1. [P40933-1]
CCDS3756.1. [P40933-2]
RefSeqiNP_000576.1. NM_000585.4. [P40933-1]
NP_751915.1. NM_172175.2. [P40933-2]
UniGeneiHs.168132.
Hs.602618.
Hs.735901.

Genome annotation databases

EnsembliENST00000296545; ENSP00000296545; ENSG00000164136. [P40933-1]
ENST00000320650; ENSP00000323505; ENSG00000164136. [P40933-1]
ENST00000394159; ENSP00000377714; ENSG00000164136. [P40933-2]
ENST00000477265; ENSP00000436914; ENSG00000164136. [P40933-2]
ENST00000514653; ENSP00000422271; ENSG00000164136. [P40933-2]
ENST00000529613; ENSP00000435462; ENSG00000164136. [P40933-1]
GeneIDi3600.
KEGGihsa:3600.
UCSCiuc003iis.4. human. [P40933-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiIL15_HUMAN
AccessioniPrimary (citable) accession number: P40933
Secondary accession number(s): D3DNZ2
, O00440, O43512, Q495Z8, Q6FGX7, Q93058, Q9UBA3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: September 27, 2017
This is version 158 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families