P40336 (VP26A_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
September 21, 2011.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Vacuolar protein sorting-associated protein 26A Alternative name(s): H<beta>58 protein Short name=H beta 58 Vesicle protein sorting 26A Short name=mVPS26 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 327 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Ref.4 |
| Subunit structure | Component of the retromer complex composed of VPS26 (VPS26A or VPS26B), VPS29, VPS35, SNX1 and SNX2. Interacts directly with VPS35. Found in a complex with XPO7, EIF4A1, ARHGAP1, VPS26A, VPS29, VPS35 and SFN By similarity. Interacts with ECM29 By similarity. |
| Subcellular location | Cytoplasm. Endosome membrane; Peripheral membrane protein Ref.4. |
| Sequence similarities | Belongs to the VPS26 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein transport Transport |
| Cellular component | Cytoplasm Endosome Membrane |
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | protein transport Inferred from electronic annotation. Source: UniProtKB-KW retrograde transport, endosome to GolgiInferred from direct assay Ref.4. Source: MGI vacuolar transportInferred from electronic annotation. Source: InterPro |
| Cellular component | cytosol Inferred from sequence or structural similarity. Source: UniProtKB endosome membraneInferred from electronic annotation. Source: UniProtKB-SubCell retromer complexInferred from electronic annotation. Source: InterPro vesicleInferred from sequence or structural similarity. Source: UniProtKB |
| Molecular function | protein binding Inferred from physical interaction. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P40336-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P40336-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSEPLPAFLDRLWGPWLGTRSPPSRSSAASPSK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 327 | 327 | Vacuolar protein sorting-associated protein 26A | PRO_0000073008 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MSEPLPAFLDRLWGPWLGTR SPPSRSSAASPSK in isoform 2. | VSP_019926 | |||||
Experimental info | |||||||||
| Sequence conflict | 37 | 1 | E → Q in BAC25745. Ref.2 | ||||||
| Sequence conflict | 71 | 1 | E → G in BAE35367. Ref.2 | ||||||
| Sequence conflict | 79 | 1 | F → L in BAE40171. Ref.2 | ||||||
| Sequence conflict | 188 | 1 | K → R in BAE40415. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of a novel, evolutionarily conserved gene disrupted by the murine H beta 58 embryonic lethal transgene insertion." Lee J.J., Radice G., Perkins C.P., Costantini F. Development 115:277-288(1992) [PubMed: 1638986] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J and DBA/2. Tissue: Amnion, Bone marrow, Lung, Placenta and Testis. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Mammary tumor. |
| [4] | "Cargo-selective endosomal sorting for retrieval to the Golgi requires retromer." Seaman M.N.J. J. Cell Biol. 165:111-122(2004) [PubMed: 15078902] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | S41204 mRNA. Translation: AAB22718.1. AK028096 mRNA. Translation: BAC25745.1. AK150244 mRNA. Translation: BAE29408.1. AK147989 mRNA. Translation: BAE28271.1. AK151360 mRNA. Translation: BAE30335.1. AK159783 mRNA. Translation: BAE35367.1. AK167592 mRNA. Translation: BAE39650.1. AK165853 mRNA. Translation: BAE38415.1. AK168213 mRNA. Translation: BAE40171.1. AK168537 mRNA. Translation: BAE40415.1. BC007148 mRNA. Translation: AAH07148.1. |
| IPI | IPI00329942. IPI00776216. |
| PIR | A44882. B44882. |
| RefSeq | NP_001106826.1. NM_001113355.1. NP_598433.1. NM_133672.3. |
| UniGene | Mm.260703. Mm.473468. |
3D structure databases | |
| ProteinModelPortal | P40336. |
| SMR | P40336. Positions 6-299. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P40336. 1 interaction. |
| STRING | P40336. |
PTM databases | |
| PhosphoSite | P40336. |
Proteomic databases | |
| PRIDE | P40336. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000092473; ENSMUSP00000090130; ENSMUSG00000020078. ENSMUST00000105447; ENSMUSP00000101087; ENSMUSG00000020078. |
| GeneID | 30930. |
| KEGG | mmu:30930. |
| UCSC | uc007fhf.2. mouse. uc007fhg.2. mouse. |
Organism-specific databases | |
| CTD | 9559. |
| MGI | MGI:1353654. Vps26a. |
Phylogenomic databases | |
| eggNOG | roNOG07380. |
| GeneTree | ENSGT00390000002588. |
| HOVERGEN | HBG082914. |
| OMA | PVCEIDV. |
| OrthoDB | EOG470THM. |
| PhylomeDB | P40336. |
Gene expression databases | |
| ArrayExpress | P40336. |
| Bgee | P40336. |
| CleanEx | MM_VPS26A. |
| Genevestigator | P40336. |
| GermOnline | ENSMUSG00000020078. Mus musculus. |
Family and domain databases | |
| InterPro | IPR005377. VPS26. [Graphical view] |
| Pfam | PF03643. Vps26. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 307338. |
| SOURCE | Search... |
Entry information
| Entry name | VP26A_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P40336 Secondary accession number(s): Q3TGY3 Q8C1E9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with