Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vacuolar protein sorting-associated protein 26A

Gene

Vps26a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. The recruitment of the CSC to the endosomal membrane involves RAB7A and SNX3.The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX3-retromer mediates the retrograde endosome-to-TGN transport of WLS distinct from the SNX-BAR retromer pathway. The SNX27-retromer is believed to be involved in endosome-to-plasma membrane trafficking and recycling of a broad spectrum of cargo proteins. The CSC complex seems to act as recruitment hub for other proteins, such as the WASH complex and TBC1D5 (By similarity). Required for retrograde transport of lysosomal enzyme receptor IGF2R (PubMed:15078902). Required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Required for the endosomal localization of FAM21 (indicative for the WASH complex). Required for the endosomal localization of TBC1D5. Mediates retromer cargo reognition of SORL1 and is involved in trafficking of SORL1 implicated in sorting and processing of APP (By similarity). Involved in retromer-independent lysosomal sorting of F2R. Involved in recycling of ADRB2 (By similarity). Acts redundantly with VSP26B in SNX-27 mediated endocytic recycling of SLC2A1/GLUT1. Enhances the affinity of SNX27 for PDZ-binding motifs in cargo proteins (PubMed:25136126).By similarity2 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Enzyme and pathway databases

ReactomeiR-MMU-3238698. WNT ligand biogenesis and trafficking.

Names & Taxonomyi

Protein namesi
Recommended name:
Vacuolar protein sorting-associated protein 26A
Alternative name(s):
H<beta>58 protein
Short name:
H beta 58
Vesicle protein sorting 26A
Short name:
mVPS26
Gene namesi
Name:Vps26a
Synonyms:Vps26
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:1353654. Vps26a.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: UniProtKB
  • early endosome Source: UniProtKB
  • endosome Source: MGI
  • endosome membrane Source: MGI
  • extracellular exosome Source: MGI
  • intracellular membrane-bounded organelle Source: MGI
  • retromer, cargo-selective complex Source: MGI
  • retromer complex Source: UniProtKB
  • tubular endosome Source: UniProtKB
  • vesicle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi44D → A: Decreases interaction with SNX27. 1 Publication1
Mutagenesisi154L → A: Decreases interaction with SNX27. 1 Publication1
Mutagenesisi235 – 236IM → DN: Disrupts interaction with VPS35:VPS29 dimer; no endosomal localization. 2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000730081 – 327Vacuolar protein sorting-associated protein 26AAdd BLAST327

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei315PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP40336.
MaxQBiP40336.
PaxDbiP40336.
PeptideAtlasiP40336.
PRIDEiP40336.

PTM databases

iPTMnetiP40336.
PhosphoSitePlusiP40336.

Expressioni

Gene expression databases

BgeeiENSMUSG00000020078.
CleanExiMM_VPS26A.
GenevisibleiP40336. MM.

Interactioni

Subunit structurei

Component of the heterotrimeric retromer cargo-selective complex (CSC), also described as vacuolar protein sorting subcomplex (VPS), formed by VPS26 (VPS26A or VPS26B), VPS29 and VPS35 (PubMed:18088321, PubMed:20875039). The CSC has a highly elongated structure with VPS26 and VPS29 binding independently at opposite distal ends of VPS35 as central platform (Probable). The CSC is believed to associate with variable sorting nexins to form functionally distinct retromer complex variants. The originally described retromer complex (also called SNX-BAR retromer) is a pentamer containing the CSC and a heterodimeric membrane-deforming subcomplex formed between SNX1 or SNX2 and SNX5 or SNX6 (also called SNX-BAR subcomplex); the respective CSC and SNX-BAR subcomplexes associate with low affinity. The CSC associates with SNX3 to form a SNX3-retromer complex. The CSC associates with SNX27, the WASH complex and the SNX-BAR subcomplex to form the SNX27-retromer complex (By similarity). Interacts with VPS29, VPS35, SNX27 (PubMed:18088321, PubMed:20875039, PubMed:25136126). Interacts with SNX1, SNX2, SNX5, SNX6, SNX3, RAB7A, ECM29, EHD1, KIAA0196, SORL1 (By similarity).1 PublicationBy similarity3 Publications

Protein-protein interaction databases

BioGridi206007. 3 interactors.
DIPiDIP-32041N.
IntActiP40336. 4 interactors.
MINTiMINT-1857150.
STRINGi10090.ENSMUSP00000090130.

Structurei

Secondary structure

1327
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi11 – 20Combined sources10
Turni21 – 23Combined sources3
Beta strandi26 – 30Combined sources5
Beta strandi36 – 42Combined sources7
Beta strandi48 – 58Combined sources11
Beta strandi63 – 77Combined sources15
Beta strandi79 – 83Combined sources5
Beta strandi86 – 96Combined sources11
Beta strandi98 – 103Combined sources6
Beta strandi105 – 111Combined sources7
Beta strandi127 – 137Combined sources11
Beta strandi143 – 151Combined sources9
Beta strandi154 – 156Combined sources3
Beta strandi164 – 169Combined sources6
Beta strandi171 – 181Combined sources11
Beta strandi183 – 186Combined sources4
Beta strandi190 – 202Combined sources13
Beta strandi204 – 216Combined sources13
Beta strandi225 – 238Combined sources14
Beta strandi246 – 251Combined sources6
Helixi252 – 254Combined sources3
Beta strandi261 – 264Combined sources4
Turni265 – 267Combined sources3
Beta strandi268 – 280Combined sources13
Beta strandi285 – 297Combined sources13

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4P2AX-ray2.70A9-327[»]
ProteinModelPortaliP40336.
SMRiP40336.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the VPS26 family.Curated

Phylogenomic databases

eggNOGiKOG3063. Eukaryota.
ENOG410XSI1. LUCA.
GeneTreeiENSGT00390000002588.
HOGENOMiHOG000191799.
HOVERGENiHBG082914.
InParanoidiP40336.
KOiK18466.
OMAiSDKSNTH.
OrthoDBiEOG091G09TQ.
PhylomeDBiP40336.
TreeFamiTF300907.

Family and domain databases

InterProiIPR028934. Vps26-related.
[Graphical view]
PfamiPF03643. Vps26. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P40336-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSFLGGFFGP ICEIDVALND GETRKMAEMK TEDGKVEKHY LFYDGESVSG
60 70 80 90 100
KVNLAFKQPG KRLEHQGIRI EFVGQIELFN DKSNTHEFVN LVKELALPGE
110 120 130 140 150
LTQSRSYDFE FMQVEKPYES YIGANVRLRY FLKVTIVRRL TDLVKEYDLI
160 170 180 190 200
VHQLATYPDV NNSIKMEVGI EDCLHIEFEY NKSKYHLKDV IVGKIYFLLV
210 220 230 240 250
RIKIQHMELQ LIKKEITGIG PSTTTETETI AKYEIMDGAP VKGESIPIRL
260 270 280 290 300
FLAGYDPTPT MRDVNKKFSV RYFLNLVLVD EEDRRYFKQQ EIILWRKAPE
310 320
KLRKQRTNFH QRFESPDSQA SAEQPEM
Length:327
Mass (Da):38,114
Last modified:February 1, 1995 - v1
Checksum:i419DAED54264AC13
GO
Isoform 2 (identifier: P40336-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSEPLPAFLDRLWGPWLGTRSPPSRSSAASPSK

Note: No experimental confirmation available.
Show »
Length:359
Mass (Da):41,548
Checksum:iE09FDBE565B7E20B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti37E → Q in BAC25745 (PubMed:16141072).Curated1
Sequence conflicti71E → G in BAE35367 (PubMed:16141072).Curated1
Sequence conflicti79F → L in BAE40171 (PubMed:16141072).Curated1
Sequence conflicti188K → R in BAE40415 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0199261M → MSEPLPAFLDRLWGPWLGTR SPPSRSSAASPSK in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S41204 mRNA. Translation: AAB22718.1.
AK028096 mRNA. Translation: BAC25745.1.
AK150244 mRNA. Translation: BAE29408.1.
AK147989 mRNA. Translation: BAE28271.1.
AK151360 mRNA. Translation: BAE30335.1.
AK159783 mRNA. Translation: BAE35367.1.
AK167592 mRNA. Translation: BAE39650.1.
AK165853 mRNA. Translation: BAE38415.1.
AK168213 mRNA. Translation: BAE40171.1.
AK168537 mRNA. Translation: BAE40415.1.
BC007148 mRNA. Translation: AAH07148.1.
CCDSiCCDS35921.1. [P40336-1]
CCDS48579.1. [P40336-2]
PIRiA44882.
B44882.
RefSeqiNP_001106826.1. NM_001113355.1. [P40336-2]
NP_598433.1. NM_133672.3. [P40336-1]
UniGeneiMm.260703.
Mm.473468.

Genome annotation databases

EnsembliENSMUST00000092473; ENSMUSP00000090130; ENSMUSG00000020078. [P40336-2]
ENSMUST00000105447; ENSMUSP00000101087; ENSMUSG00000020078. [P40336-1]
GeneIDi30930.
KEGGimmu:30930.
UCSCiuc007fhf.2. mouse. [P40336-2]
uc007fhg.2. mouse. [P40336-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S41204 mRNA. Translation: AAB22718.1.
AK028096 mRNA. Translation: BAC25745.1.
AK150244 mRNA. Translation: BAE29408.1.
AK147989 mRNA. Translation: BAE28271.1.
AK151360 mRNA. Translation: BAE30335.1.
AK159783 mRNA. Translation: BAE35367.1.
AK167592 mRNA. Translation: BAE39650.1.
AK165853 mRNA. Translation: BAE38415.1.
AK168213 mRNA. Translation: BAE40171.1.
AK168537 mRNA. Translation: BAE40415.1.
BC007148 mRNA. Translation: AAH07148.1.
CCDSiCCDS35921.1. [P40336-1]
CCDS48579.1. [P40336-2]
PIRiA44882.
B44882.
RefSeqiNP_001106826.1. NM_001113355.1. [P40336-2]
NP_598433.1. NM_133672.3. [P40336-1]
UniGeneiMm.260703.
Mm.473468.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4P2AX-ray2.70A9-327[»]
ProteinModelPortaliP40336.
SMRiP40336.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi206007. 3 interactors.
DIPiDIP-32041N.
IntActiP40336. 4 interactors.
MINTiMINT-1857150.
STRINGi10090.ENSMUSP00000090130.

PTM databases

iPTMnetiP40336.
PhosphoSitePlusiP40336.

Proteomic databases

EPDiP40336.
MaxQBiP40336.
PaxDbiP40336.
PeptideAtlasiP40336.
PRIDEiP40336.

Protocols and materials databases

DNASUi30930.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000092473; ENSMUSP00000090130; ENSMUSG00000020078. [P40336-2]
ENSMUST00000105447; ENSMUSP00000101087; ENSMUSG00000020078. [P40336-1]
GeneIDi30930.
KEGGimmu:30930.
UCSCiuc007fhf.2. mouse. [P40336-2]
uc007fhg.2. mouse. [P40336-1]

Organism-specific databases

CTDi9559.
MGIiMGI:1353654. Vps26a.

Phylogenomic databases

eggNOGiKOG3063. Eukaryota.
ENOG410XSI1. LUCA.
GeneTreeiENSGT00390000002588.
HOGENOMiHOG000191799.
HOVERGENiHBG082914.
InParanoidiP40336.
KOiK18466.
OMAiSDKSNTH.
OrthoDBiEOG091G09TQ.
PhylomeDBiP40336.
TreeFamiTF300907.

Enzyme and pathway databases

ReactomeiR-MMU-3238698. WNT ligand biogenesis and trafficking.

Miscellaneous databases

PROiP40336.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020078.
CleanExiMM_VPS26A.
GenevisibleiP40336. MM.

Family and domain databases

InterProiIPR028934. Vps26-related.
[Graphical view]
PfamiPF03643. Vps26. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiVP26A_MOUSE
AccessioniPrimary (citable) accession number: P40336
Secondary accession number(s): Q3TGY3
, Q3THM5, Q3TW99, Q3UD54, Q8C1E9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: November 30, 2016
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.