Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

S-adenosylmethionine synthase

Gene

Sam-S

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Catalyzes the formation of S-adenosylmethionine from methionine and ATP.1 Publication

Catalytic activityi

ATP + L-methionine + H2O = phosphate + diphosphate + S-adenosyl-L-methionine.

Cofactori

Protein has several cofactor binding sites:
  • Mg2+By similarity, Co2+By similarityNote: Binds 2 divalent ions per subunit. Magnesium or cobalt.By similarity
  • K+By similarityNote: Binds 1 potassium ion per subunit.By similarity

Pathwayi: S-adenosyl-L-methionine biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes S-adenosyl-L-methionine from L-methionine.
Proteins known to be involved in this subpathway in this organism are:
  1. S-adenosylmethionine synthase (Sam-S), S-adenosylmethionine synthase (Sam-S)
This subpathway is part of the pathway S-adenosyl-L-methionine biosynthesis, which is itself part of Amino-acid biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes S-adenosyl-L-methionine from L-methionine, the pathway S-adenosyl-L-methionine biosynthesis and in Amino-acid biosynthesis.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi42 – 421MagnesiumBy similarity
Metal bindingi68 – 681PotassiumBy similarity
Binding sitei170 – 1701ATPSequence analysis
Metal bindingi294 – 2941PotassiumBy similarity
Metal bindingi302 – 3021MagnesiumBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi142 – 1476ATPSequence analysis

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • metal ion binding Source: UniProtKB-KW
  • methionine adenosyltransferase activity Source: FlyBase

GO - Biological processi

  • chaeta development Source: FlyBase
  • determination of adult lifespan Source: FlyBase
  • one-carbon metabolic process Source: FlyBase
  • S-adenosylmethionine biosynthetic process Source: FlyBase
  • wing disc development Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

One-carbon metabolism

Keywords - Ligandi

ATP-binding, Cobalt, Magnesium, Metal-binding, Nucleotide-binding, Potassium

Enzyme and pathway databases

ReactomeiR-DME-156581. Methylation.
R-DME-1614635. Sulfur amino acid metabolism.
R-DME-2408508. Metabolism of ingested SeMet, Sec, MeSec into H2Se.
UniPathwayiUPA00315; UER00080.

Names & Taxonomyi

Protein namesi
Recommended name:
S-adenosylmethionine synthase (EC:2.5.1.6)
Short name:
AdoMet synthase
Alternative name(s):
Methionine adenosyltransferase
Short name:
MAT
Gene namesi
Name:Sam-S
Synonyms:M(2)21AB, SamS
ORF Names:CG2674
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2L

Organism-specific databases

FlyBaseiFBgn0005278. Sam-S.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 408408S-adenosylmethionine synthasePRO_0000174446Add
BLAST

Proteomic databases

PaxDbiP40320.
PRIDEiP40320.

Expressioni

Developmental stagei

Expressed both maternally and zygotically. Expressed throughout development with highest levels at adult stages.1 Publication

Gene expression databases

BgeeiFBgn0005278.
ExpressionAtlasiP40320. differential.
GenevisibleiP40320. DM.

Interactioni

Protein-protein interaction databases

BioGridi71491. 18 interactions.
DIPiDIP-18340N.
IntActiP40320. 9 interactions.
STRINGi7227.FBpp0088926.

Structurei

3D structure databases

ProteinModelPortaliP40320.
SMRiP40320. Positions 27-405.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AdoMet synthase family.Curated

Phylogenomic databases

eggNOGiKOG1506. Eukaryota.
COG0192. LUCA.
GeneTreeiENSGT00500000044811.
HOGENOMiHOG000120097.
InParanoidiP40320.
KOiK00789.
OMAiIQDNGAV.
OrthoDBiEOG091G08Z2.
PhylomeDBiP40320.

Family and domain databases

HAMAPiMF_00086. S_AdoMet_synth1. 1 hit.
InterProiIPR022631. ADOMET_SYNTHASE_CS.
IPR022630. S-AdoMet_synt_C.
IPR022629. S-AdoMet_synt_central.
IPR022628. S-AdoMet_synt_N.
IPR002133. S-AdoMet_synthetase.
IPR022636. S-AdoMet_synthetase_sfam.
[Graphical view]
PANTHERiPTHR11964. PTHR11964. 1 hit.
PfamiPF02773. S-AdoMet_synt_C. 1 hit.
PF02772. S-AdoMet_synt_M. 1 hit.
PF00438. S-AdoMet_synt_N. 1 hit.
[Graphical view]
PIRSFiPIRSF000497. MAT. 1 hit.
SUPFAMiSSF55973. SSF55973. 3 hits.
TIGRFAMsiTIGR01034. metK. 1 hit.
PROSITEiPS00376. ADOMET_SYNTHASE_1. 1 hit.
PS00377. ADOMET_SYNTHASE_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: P40320-1) [UniParc]FASTAAdd to basket
Also known as: A, D

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPQKTNGHSA NGCNGSNGNS YDMEDGATFL FTSESVGEGH PDKMCDQISD
60 70 80 90 100
AILDAHLKQD PNAKVACETV AKTGMILLCG EITSKAVVDY QKVVRETVQH
110 120 130 140 150
IGYDDSSKGF DFKTCNVLLA LDQQSPEIAA GVHVNRAEEE IGAGDQGIMF
160 170 180 190 200
GYATDETEEC MPLTVVLAHK LNEKIAELRR SDVFWWARPD SKTQVTCEYL
210 220 230 240 250
FNQGSAVPKR VHTIVVSMQH SEKISLETLR SEVMEKVVKV VIPAKYIDAN
260 270 280 290 300
TIVHINPCGL FVIGGPMGDA GLTGRKIIVD TYGGWGAHGG GAFSGKDFTK
310 320 330 340 350
VDRSAAYAAR WVAKSLVKAG LCKRCLVQVS YAIGLAEPLS ITVFDYGTSH
360 370 380 390 400
KSQKELLDII RRNFDLRPGK IVKDLNLRQP IYQRTSTYGH FGRAGFSWEE

AKPLEIDN
Length:408
Mass (Da):44,697
Last modified:November 28, 2002 - v2
Checksum:iCA0F97C1EA6623DF
GO
Isoform 1 (identifier: P40320-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     112-141: FKTCNVLLALDQQSPEIAAGVHVNRAEEEI → WKTLNLLVAIEQQSPNIANGVHINREEEDV
     147-200: GIMFGYATDE...SKTQVTCEYL → VSISKRAMCC...PPTKPRNVCP
     201-408: Missing.

Show »
Length:200
Mass (Da):22,037
Checksum:i85332A5181EC863B
GO
Isoform 3 (identifier: P40320-3) [UniParc]FASTAAdd to basket
Also known as: C, J

The sequence of this isoform differs from the canonical sequence as follows:
     112-141: FKTCNVLLALDQQSPEIAAGVHVNRAEEEI → WKTLNLLVAIEQQSPNIANGVHINREEEDV

Show »
Length:408
Mass (Da):44,832
Checksum:i0E0BA875821D15EA
GO
Isoform 4 (identifier: P40320-4) [UniParc]FASTAAdd to basket
Also known as: G

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.
     28-41: TFLFTSESVGEGHP → MISAECHSEEYTPN
     112-141: FKTCNVLLALDQQSPEIAAGVHVNRAEEEI → WKTLNLLVAIEQQSPNIANGVHINREEEDV

Show »
Length:381
Mass (Da):42,196
Checksum:i3A1BDEB76C5ECE3D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti34 – 341E → V in CAA54567 (PubMed:8150093).Curated
Sequence conflicti94 – 941V → I in CAA54567 (PubMed:8150093).Curated
Sequence conflicti290 – 2901G → A in CAA54567 (PubMed:8150093).Curated
Sequence conflicti400 – 4089EAKPLEIDN → SQASGD in CAA54567 (PubMed:8150093).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2727Missing in isoform 4. CuratedVSP_005961Add
BLAST
Alternative sequencei28 – 4114TFLFT…GEGHP → MISAECHSEEYTPN in isoform 4. CuratedVSP_005962Add
BLAST
Alternative sequencei112 – 14130FKTCN…AEEEI → WKTLNLLVAIEQQSPNIANG VHINREEEDV in isoform 1, isoform 3 and isoform 4. CuratedVSP_005963Add
BLAST
Alternative sequencei147 – 20054GIMFG…TCEYL → VSISKRAMCCWHWTNNRLRS LRECMSTVPRKRSVPEIRVS CLDMPPTKPRNVCP in isoform 1. CuratedVSP_005964Add
BLAST
Alternative sequencei201 – 408208Missing in isoform 1. CuratedVSP_005965Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X77392 mRNA. Translation: CAA54567.1.
AE014134 Genomic DNA. Translation: AAF51555.1.
AE014134 Genomic DNA. Translation: AAF51556.1.
AE014134 Genomic DNA. Translation: AAF51557.1.
AE014134 Genomic DNA. Translation: AAF51558.1.
AE014134 Genomic DNA. Translation: AAN10505.1.
AE014134 Genomic DNA. Translation: AAN10506.1.
AE014134 Genomic DNA. Translation: AAN10507.1.
AE014134 Genomic DNA. Translation: AAS64636.1.
AY051918 mRNA. Translation: AAK93342.1.
PIRiS43258. S41917.
RefSeqiNP_524923.1. NM_080184.2. [P40320-3]
NP_722593.1. NM_164355.3. [P40320-3]
NP_722594.1. NM_164356.2. [P40320-1]
NP_722595.1. NM_164357.2. [P40320-1]
NP_722596.1. NM_164358.2. [P40320-1]
NP_722597.1. NM_164359.2. [P40320-1]
NP_722598.1. NM_164360.3. [P40320-1]
NP_722599.1. NM_164361.2. [P40320-2]
NP_722600.1. NM_164362.3. [P40320-4]
NP_995602.1. NM_205880.1. [P40320-1]
UniGeneiDm.7020.

Genome annotation databases

EnsemblMetazoaiFBtr0089429; FBpp0088445; FBgn0005278. [P40320-1]
FBtr0089430; FBpp0088446; FBgn0005278. [P40320-1]
FBtr0089432; FBpp0088448; FBgn0005278. [P40320-1]
FBtr0089433; FBpp0088449; FBgn0005278. [P40320-1]
FBtr0089434; FBpp0088450; FBgn0005278. [P40320-1]
FBtr0089437; FBpp0088926; FBgn0005278. [P40320-1]
GeneIDi48552.
KEGGidme:Dmel_CG2674.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X77392 mRNA. Translation: CAA54567.1.
AE014134 Genomic DNA. Translation: AAF51555.1.
AE014134 Genomic DNA. Translation: AAF51556.1.
AE014134 Genomic DNA. Translation: AAF51557.1.
AE014134 Genomic DNA. Translation: AAF51558.1.
AE014134 Genomic DNA. Translation: AAN10505.1.
AE014134 Genomic DNA. Translation: AAN10506.1.
AE014134 Genomic DNA. Translation: AAN10507.1.
AE014134 Genomic DNA. Translation: AAS64636.1.
AY051918 mRNA. Translation: AAK93342.1.
PIRiS43258. S41917.
RefSeqiNP_524923.1. NM_080184.2. [P40320-3]
NP_722593.1. NM_164355.3. [P40320-3]
NP_722594.1. NM_164356.2. [P40320-1]
NP_722595.1. NM_164357.2. [P40320-1]
NP_722596.1. NM_164358.2. [P40320-1]
NP_722597.1. NM_164359.2. [P40320-1]
NP_722598.1. NM_164360.3. [P40320-1]
NP_722599.1. NM_164361.2. [P40320-2]
NP_722600.1. NM_164362.3. [P40320-4]
NP_995602.1. NM_205880.1. [P40320-1]
UniGeneiDm.7020.

3D structure databases

ProteinModelPortaliP40320.
SMRiP40320. Positions 27-405.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi71491. 18 interactions.
DIPiDIP-18340N.
IntActiP40320. 9 interactions.
STRINGi7227.FBpp0088926.

Proteomic databases

PaxDbiP40320.
PRIDEiP40320.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0089429; FBpp0088445; FBgn0005278. [P40320-1]
FBtr0089430; FBpp0088446; FBgn0005278. [P40320-1]
FBtr0089432; FBpp0088448; FBgn0005278. [P40320-1]
FBtr0089433; FBpp0088449; FBgn0005278. [P40320-1]
FBtr0089434; FBpp0088450; FBgn0005278. [P40320-1]
FBtr0089437; FBpp0088926; FBgn0005278. [P40320-1]
GeneIDi48552.
KEGGidme:Dmel_CG2674.

Organism-specific databases

CTDi48552.
FlyBaseiFBgn0005278. Sam-S.

Phylogenomic databases

eggNOGiKOG1506. Eukaryota.
COG0192. LUCA.
GeneTreeiENSGT00500000044811.
HOGENOMiHOG000120097.
InParanoidiP40320.
KOiK00789.
OMAiIQDNGAV.
OrthoDBiEOG091G08Z2.
PhylomeDBiP40320.

Enzyme and pathway databases

UniPathwayiUPA00315; UER00080.
ReactomeiR-DME-156581. Methylation.
R-DME-1614635. Sulfur amino acid metabolism.
R-DME-2408508. Metabolism of ingested SeMet, Sec, MeSec into H2Se.

Miscellaneous databases

ChiTaRSiSam-S. fly.
GenomeRNAii48552.
PROiP40320.

Gene expression databases

BgeeiFBgn0005278.
ExpressionAtlasiP40320. differential.
GenevisibleiP40320. DM.

Family and domain databases

HAMAPiMF_00086. S_AdoMet_synth1. 1 hit.
InterProiIPR022631. ADOMET_SYNTHASE_CS.
IPR022630. S-AdoMet_synt_C.
IPR022629. S-AdoMet_synt_central.
IPR022628. S-AdoMet_synt_N.
IPR002133. S-AdoMet_synthetase.
IPR022636. S-AdoMet_synthetase_sfam.
[Graphical view]
PANTHERiPTHR11964. PTHR11964. 1 hit.
PfamiPF02773. S-AdoMet_synt_C. 1 hit.
PF02772. S-AdoMet_synt_M. 1 hit.
PF00438. S-AdoMet_synt_N. 1 hit.
[Graphical view]
PIRSFiPIRSF000497. MAT. 1 hit.
SUPFAMiSSF55973. SSF55973. 3 hits.
TIGRFAMsiTIGR01034. metK. 1 hit.
PROSITEiPS00376. ADOMET_SYNTHASE_1. 1 hit.
PS00377. ADOMET_SYNTHASE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMETK_DROME
AccessioniPrimary (citable) accession number: P40320
Secondary accession number(s): Q0E8V3
, Q9VPJ2, Q9VPJ3, Q9VPJ4, Q9VPJ5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: November 28, 2002
Last modified: September 7, 2016
This is version 152 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.