Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Carcinoembryonic antigen-related cell adhesion molecule 3

Gene

CEACAM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.2 Publications

Enzyme and pathway databases

BioCyciZFISH:ENSG00000170956-MONOMER.
ReactomeiR-HSA-6798695. Neutrophil degranulation.

Names & Taxonomyi

Protein namesi
Recommended name:
Carcinoembryonic antigen-related cell adhesion molecule 3
Alternative name(s):
Carcinoembryonic antigen CGM1
CD_antigen: CD66d
Gene namesi
Name:CEACAM3
Synonyms:CD66D, CGM1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:1815. CEACAM3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini35 – 155ExtracellularSequence analysisAdd BLAST121
Transmembranei156 – 176HelicalSequence analysisAdd BLAST21
Topological domaini177 – 252CytoplasmicSequence analysisAdd BLAST76

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi230Y → F: Loss of phosphorylation and 30% reduction in bacterial uptake. More than 60% reduction in bacterial uptake and loss of RAC1 stimulation; when associated with F-241. 2 Publications1
Mutagenesisi241Y → F: Loss of phosphorylation and 30% reduction in bacterial uptake. More than 60% reduction in bacterial uptake and loss of RAC1 stimulation; when associated with F-230. 2 Publications1

Organism-specific databases

DisGeNETi1084.
OpenTargetsiENSG00000170956.
PharmGKBiPA26359.

Polymorphism and mutation databases

DMDMi218511974.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 34By similarityAdd BLAST34
ChainiPRO_000001456535 – 252Carcinoembryonic antigen-related cell adhesion molecule 3Add BLAST218

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi104N-linked (GlcNAc...)Sequence analysis1
Glycosylationi111N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

Tyrosine-phosphorylated in response to microbial binding. Tyr-230 and Tyr-241 are both required for phosphorylation to be detected.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP40198.
PaxDbiP40198.
PeptideAtlasiP40198.
PRIDEiP40198.

PTM databases

iPTMnetiP40198.
PhosphoSitePlusiP40198.

Expressioni

Tissue specificityi

CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, prostate, small intestine, heart, lung and kidney.1 Publication

Gene expression databases

BgeeiENSG00000170956.
CleanExiHS_CEACAM3.
ExpressionAtlasiP40198. baseline and differential.
GenevisibleiP40198. HS.

Organism-specific databases

HPAiHPA011041.

Interactioni

Subunit structurei

Interacts with S100A9/calprotectin. This interaction is calcium-dependent, but independent of CEACAM3 phosphorylation.1 Publication

Protein-protein interaction databases

STRINGi9606.ENSP00000349971.

Structurei

3D structure databases

ProteinModelPortaliP40198.
SMRiP40198.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini35 – 142Ig-like V-typeAdd BLAST108

Domaini

The cytosolic domain is involved in S100A9 interaction.

Sequence similaritiesi

Belongs to the immunoglobulin superfamily. CEA family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410JC48. Eukaryota.
ENOG4111ARQ. LUCA.
GeneTreeiENSGT00760000119187.
HOGENOMiHOG000233417.
HOVERGENiHBG007922.
InParanoidiP40198.
KOiK06499.
OMAiTIESSCL.
OrthoDBiEOG091G0AMM.
PhylomeDBiP40198.
TreeFamiTF336859.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P40198-1) [UniParc]FASTAAdd to basket
Also known as: CGM1A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGPPSASPHR ECIPWQGLLL TASLLNFWNP PTTAKLTIES MPLSVAEGKE
60 70 80 90 100
VLLLVHNLPQ HLFGYSWYKG ERVDGNSLIV GYVIGTQQAT PGAAYSGRET
110 120 130 140 150
IYTNASLLIQ NVTQNDIGFY TLQVIKSDLV NEEATGQFHV YQENAPGLPV
160 170 180 190 200
GAVAGIVTGV LVGVALVAAL VCFLLLAKTG RTSIQRDLKE QQPQALAPGR
210 220 230 240 250
GPSHSSAFSM SPLSTAQAPL PNPRTAASIY EELLKHDTNI YCRMDHKAEV

AS
Length:252
Mass (Da):27,091
Last modified:December 16, 2008 - v2
Checksum:i179F0C51C6A062A1
GO
Isoform 2 (identifier: P40198-2) [UniParc]FASTAAdd to basket
Also known as: CGM1B

The sequence of this isoform differs from the canonical sequence as follows:
     142-252: QENAPGLPVG...RMDHKAEVAS → PELPKPSISS...EPEIHSTTCL

Show »
Length:177
Mass (Da):19,403
Checksum:iC0BF243D56686F8C
GO
Isoform 3 (identifier: P40198-3) [UniParc]FASTAAdd to basket
Also known as: CGM1C

The sequence of this isoform differs from the canonical sequence as follows:
     182-252: TSIQRDLKEQ...RMDHKAEVAS → PWSLPQLCLLDVPSLHCPGPPTQPQDSSFHL

Show »
Length:212
Mass (Da):22,754
Checksum:iA146AF256C9F0B62
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti49K → N in BAA14321 (PubMed:2050678).Curated1
Sequence conflicti84I → T in BAA14322 (PubMed:2050678).Curated1
Sequence conflicti137Q → H in BAA14322 (PubMed:2050678).Curated1
Sequence conflicti215T → S in AAA51969 (PubMed:8508798).Curated1
Isoform 3 (identifier: P40198-3)
Sequence conflicti199P → L in AAA51970 (PubMed:8508798).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0039057S → P.1 PublicationCorresponds to variant rs1041999dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002486142 – 252QENAP…AEVAS → PELPKPSISSNNSNPKEDKD AVAFTCEPEIHSTTCL in isoform 2. 1 PublicationAdd BLAST111
Alternative sequenceiVSP_002487182 – 252TSIQR…AEVAS → PWSLPQLCLLDVPSLHCPGP PTQPQDSSFHL in isoform 3. 1 PublicationAdd BLAST71

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90277 mRNA. Translation: BAA14321.1.
D90278 mRNA. Translation: BAA14322.1.
L00692 mRNA. Translation: AAA51969.1.
L00693 mRNA. Translation: AAA51970.1.
AC022516 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW57062.1.
CH471126 Genomic DNA. Translation: EAW57063.1.
BC106728 mRNA. Translation: AAI06729.1.
CCDSiCCDS12586.2. [P40198-1]
CCDS62685.1. [P40198-3]
PIRiC40428.
S33323.
S33324.
RefSeqiNP_001264092.1. NM_001277163.2. [P40198-3]
NP_001806.2. NM_001815.4. [P40198-1]
UniGeneiHs.11.

Genome annotation databases

EnsembliENST00000344550; ENSP00000341725; ENSG00000170956. [P40198-3]
ENST00000357396; ENSP00000349971; ENSG00000170956. [P40198-1]
ENST00000415495; ENSP00000411641; ENSG00000170956. [P40198-2]
ENST00000630848; ENSP00000485920; ENSG00000170956. [P40198-3]
GeneIDi1084.
KEGGihsa:1084.
UCSCiuc032hyd.2. human. [P40198-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90277 mRNA. Translation: BAA14321.1.
D90278 mRNA. Translation: BAA14322.1.
L00692 mRNA. Translation: AAA51969.1.
L00693 mRNA. Translation: AAA51970.1.
AC022516 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW57062.1.
CH471126 Genomic DNA. Translation: EAW57063.1.
BC106728 mRNA. Translation: AAI06729.1.
CCDSiCCDS12586.2. [P40198-1]
CCDS62685.1. [P40198-3]
PIRiC40428.
S33323.
S33324.
RefSeqiNP_001264092.1. NM_001277163.2. [P40198-3]
NP_001806.2. NM_001815.4. [P40198-1]
UniGeneiHs.11.

3D structure databases

ProteinModelPortaliP40198.
SMRiP40198.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000349971.

PTM databases

iPTMnetiP40198.
PhosphoSitePlusiP40198.

Polymorphism and mutation databases

DMDMi218511974.

Proteomic databases

MaxQBiP40198.
PaxDbiP40198.
PeptideAtlasiP40198.
PRIDEiP40198.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000344550; ENSP00000341725; ENSG00000170956. [P40198-3]
ENST00000357396; ENSP00000349971; ENSG00000170956. [P40198-1]
ENST00000415495; ENSP00000411641; ENSG00000170956. [P40198-2]
ENST00000630848; ENSP00000485920; ENSG00000170956. [P40198-3]
GeneIDi1084.
KEGGihsa:1084.
UCSCiuc032hyd.2. human. [P40198-1]

Organism-specific databases

CTDi1084.
DisGeNETi1084.
GeneCardsiCEACAM3.
HGNCiHGNC:1815. CEACAM3.
HPAiHPA011041.
MIMi609142. gene.
neXtProtiNX_P40198.
OpenTargetsiENSG00000170956.
PharmGKBiPA26359.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JC48. Eukaryota.
ENOG4111ARQ. LUCA.
GeneTreeiENSGT00760000119187.
HOGENOMiHOG000233417.
HOVERGENiHBG007922.
InParanoidiP40198.
KOiK06499.
OMAiTIESSCL.
OrthoDBiEOG091G0AMM.
PhylomeDBiP40198.
TreeFamiTF336859.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000170956-MONOMER.
ReactomeiR-HSA-6798695. Neutrophil degranulation.

Miscellaneous databases

GeneWikiiCEACAM3.
GenomeRNAii1084.
PROiP40198.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000170956.
CleanExiHS_CEACAM3.
ExpressionAtlasiP40198. baseline and differential.
GenevisibleiP40198. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiCEAM3_HUMAN
AccessioniPrimary (citable) accession number: P40198
Secondary accession number(s): G5E978, Q3KPH9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: December 16, 2008
Last modified: November 30, 2016
This is version 148 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

This is not the ortholog of rat CEACAM3.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.