Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Carcinoembryonic antigen-related cell adhesion molecule 3

Gene

CEACAM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.2 Publications

Names & Taxonomyi

Protein namesi
Recommended name:
Carcinoembryonic antigen-related cell adhesion molecule 3
Alternative name(s):
Carcinoembryonic antigen CGM1
CD_antigen: CD66d
Gene namesi
Name:CEACAM3
Synonyms:CD66D, CGM1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:1815. CEACAM3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini35 – 155121ExtracellularSequence analysisAdd
BLAST
Transmembranei156 – 17621HelicalSequence analysisAdd
BLAST
Topological domaini177 – 25276CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi230 – 2301Y → F: Loss of phosphorylation and 30% reduction in bacterial uptake. More than 60% reduction in bacterial uptake and loss of RAC1 stimulation; when associated with F-241. 2 Publications
Mutagenesisi241 – 2411Y → F: Loss of phosphorylation and 30% reduction in bacterial uptake. More than 60% reduction in bacterial uptake and loss of RAC1 stimulation; when associated with F-230. 2 Publications

Organism-specific databases

PharmGKBiPA26359.

Polymorphism and mutation databases

DMDMi218511974.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3434By similarityAdd
BLAST
Chaini35 – 252218Carcinoembryonic antigen-related cell adhesion molecule 3PRO_0000014565Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi104 – 1041N-linked (GlcNAc...)Sequence analysis
Glycosylationi111 – 1111N-linked (GlcNAc...)Sequence analysis

Post-translational modificationi

Tyrosine-phosphorylated in response to microbial binding. Tyr-230 and Tyr-241 are both required for phosphorylation to be detected.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP40198.
PaxDbiP40198.
PRIDEiP40198.

PTM databases

PhosphoSiteiP40198.

Expressioni

Tissue specificityi

CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, prostate, small intestine, heart, lung and kidney.1 Publication

Gene expression databases

BgeeiP40198.
CleanExiHS_CEACAM3.
ExpressionAtlasiP40198. baseline and differential.
GenevisibleiP40198. HS.

Organism-specific databases

HPAiHPA011041.

Interactioni

Subunit structurei

Interacts with S100A9/calprotectin. This interaction is calcium-dependent, but independent of CEACAM3 phosphorylation.1 Publication

Protein-protein interaction databases

STRINGi9606.ENSP00000349971.

Structurei

3D structure databases

ProteinModelPortaliP40198.
SMRiP40198. Positions 35-141.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 142108Ig-like V-typeAdd
BLAST

Domaini

The cytosolic domain is involved in S100A9 interaction.

Sequence similaritiesi

Belongs to the immunoglobulin superfamily. CEA family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410JC48. Eukaryota.
ENOG4111ARQ. LUCA.
GeneTreeiENSGT00760000119187.
HOGENOMiHOG000233417.
HOVERGENiHBG007922.
InParanoidiP40198.
KOiK06499.
OMAiTIESSCL.
OrthoDBiEOG74BJS7.
PhylomeDBiP40198.
TreeFamiTF336859.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P40198-1) [UniParc]FASTAAdd to basket

Also known as: CGM1A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGPPSASPHR ECIPWQGLLL TASLLNFWNP PTTAKLTIES MPLSVAEGKE
60 70 80 90 100
VLLLVHNLPQ HLFGYSWYKG ERVDGNSLIV GYVIGTQQAT PGAAYSGRET
110 120 130 140 150
IYTNASLLIQ NVTQNDIGFY TLQVIKSDLV NEEATGQFHV YQENAPGLPV
160 170 180 190 200
GAVAGIVTGV LVGVALVAAL VCFLLLAKTG RTSIQRDLKE QQPQALAPGR
210 220 230 240 250
GPSHSSAFSM SPLSTAQAPL PNPRTAASIY EELLKHDTNI YCRMDHKAEV

AS
Length:252
Mass (Da):27,091
Last modified:December 16, 2008 - v2
Checksum:i179F0C51C6A062A1
GO
Isoform 2 (identifier: P40198-2) [UniParc]FASTAAdd to basket

Also known as: CGM1B

The sequence of this isoform differs from the canonical sequence as follows:
     142-252: QENAPGLPVG...RMDHKAEVAS → PELPKPSISS...EPEIHSTTCL

Show »
Length:177
Mass (Da):19,403
Checksum:iC0BF243D56686F8C
GO
Isoform 3 (identifier: P40198-3) [UniParc]FASTAAdd to basket

Also known as: CGM1C

The sequence of this isoform differs from the canonical sequence as follows:
     182-252: TSIQRDLKEQ...RMDHKAEVAS → PWSLPQLCLLDVPSLHCPGPPTQPQDSSFHL

Show »
Length:212
Mass (Da):22,754
Checksum:iA146AF256C9F0B62
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti49 – 491K → N in BAA14321 (PubMed:2050678).Curated
Sequence conflicti84 – 841I → T in BAA14322 (PubMed:2050678).Curated
Sequence conflicti137 – 1371Q → H in BAA14322 (PubMed:2050678).Curated
Sequence conflicti215 – 2151T → S in AAA51969 (PubMed:8508798).Curated
Isoform 3 (identifier: P40198-3)
Sequence conflicti199 – 1991P → L in AAA51970 (PubMed:8508798).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti7 – 71S → P.1 Publication
Corresponds to variant rs1041999 [ dbSNP | Ensembl ].
VAR_003905

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei142 – 252111QENAP…AEVAS → PELPKPSISSNNSNPKEDKD AVAFTCEPEIHSTTCL in isoform 2. 1 PublicationVSP_002486Add
BLAST
Alternative sequencei182 – 25271TSIQR…AEVAS → PWSLPQLCLLDVPSLHCPGP PTQPQDSSFHL in isoform 3. 1 PublicationVSP_002487Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90277 mRNA. Translation: BAA14321.1.
D90278 mRNA. Translation: BAA14322.1.
L00692 mRNA. Translation: AAA51969.1.
L00693 mRNA. Translation: AAA51970.1.
AC022516 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW57062.1.
CH471126 Genomic DNA. Translation: EAW57063.1.
BC106728 mRNA. Translation: AAI06729.1.
CCDSiCCDS12586.2. [P40198-1]
CCDS62685.1. [P40198-3]
PIRiC40428.
S33323.
S33324.
RefSeqiNP_001264092.1. NM_001277163.2. [P40198-3]
NP_001806.2. NM_001815.4. [P40198-1]
UniGeneiHs.11.

Genome annotation databases

EnsembliENST00000344550; ENSP00000341725; ENSG00000170956. [P40198-3]
ENST00000357396; ENSP00000349971; ENSG00000170956. [P40198-1]
ENST00000415495; ENSP00000411641; ENSG00000170956. [P40198-2]
ENST00000630848; ENSP00000485920; ENSG00000170956. [P40198-3]
GeneIDi1084.
KEGGihsa:1084.
UCSCiuc032hyd.2. human. [P40198-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90277 mRNA. Translation: BAA14321.1.
D90278 mRNA. Translation: BAA14322.1.
L00692 mRNA. Translation: AAA51969.1.
L00693 mRNA. Translation: AAA51970.1.
AC022516 Genomic DNA. No translation available.
CH471126 Genomic DNA. Translation: EAW57062.1.
CH471126 Genomic DNA. Translation: EAW57063.1.
BC106728 mRNA. Translation: AAI06729.1.
CCDSiCCDS12586.2. [P40198-1]
CCDS62685.1. [P40198-3]
PIRiC40428.
S33323.
S33324.
RefSeqiNP_001264092.1. NM_001277163.2. [P40198-3]
NP_001806.2. NM_001815.4. [P40198-1]
UniGeneiHs.11.

3D structure databases

ProteinModelPortaliP40198.
SMRiP40198. Positions 35-141.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000349971.

PTM databases

PhosphoSiteiP40198.

Polymorphism and mutation databases

DMDMi218511974.

Proteomic databases

MaxQBiP40198.
PaxDbiP40198.
PRIDEiP40198.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000344550; ENSP00000341725; ENSG00000170956. [P40198-3]
ENST00000357396; ENSP00000349971; ENSG00000170956. [P40198-1]
ENST00000415495; ENSP00000411641; ENSG00000170956. [P40198-2]
ENST00000630848; ENSP00000485920; ENSG00000170956. [P40198-3]
GeneIDi1084.
KEGGihsa:1084.
UCSCiuc032hyd.2. human. [P40198-1]

Organism-specific databases

CTDi1084.
GeneCardsiCEACAM3.
HGNCiHGNC:1815. CEACAM3.
HPAiHPA011041.
MIMi609142. gene.
neXtProtiNX_P40198.
PharmGKBiPA26359.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JC48. Eukaryota.
ENOG4111ARQ. LUCA.
GeneTreeiENSGT00760000119187.
HOGENOMiHOG000233417.
HOVERGENiHBG007922.
InParanoidiP40198.
KOiK06499.
OMAiTIESSCL.
OrthoDBiEOG74BJS7.
PhylomeDBiP40198.
TreeFamiTF336859.

Miscellaneous databases

GeneWikiiCEACAM3.
GenomeRNAii1084.
NextBioi35518125.
PROiP40198.
SOURCEiSearch...

Gene expression databases

BgeeiP40198.
CleanExiHS_CEACAM3.
ExpressionAtlasiP40198. baseline and differential.
GenevisibleiP40198. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07686. V-set. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of nonspecific cross-reacting antigens in human granulocytes."
    Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Misumi Y., Nakazato H., Matsuoka Y.
    J. Biol. Chem. 266:11810-11817(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT PRO-7.
    Tissue: Leukocyte.
  2. "Genomic organization, splice variants and expression of CGM1, a CD66-related member of the carcinoembryonic antigen gene family."
    Nagel G., Grunert F., Kuijpers T.W., Watt S.M., Thompson J., Zimmermann W.A.
    Eur. J. Biochem. 214:27-35(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3).
  3. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. "Identification of three new genes and estimation of the size of the carcinoembryonic antigen family."
    Khan W.N., Fraengsmyr L., Teglund S., Israelsson A., Bremer K., Hammarstroem S.
    Genomics 14:384-390(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 35-141.
  7. "The microbial receptor CEACAM3 is linked to the calprotectin complex in granulocytes."
    Streichert T., Ebrahimnejad A., Ganzer S., Flayeh R., Wagener C., Bruemmer J.
    Biochem. Biophys. Res. Commun. 289:191-197(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH S100A9, TISSUE SPECIFICITY.
  8. "Immunoreceptor tyrosine-based activation motif phosphorylation during engulfment of Neisseria gonorrhoeae by the neutrophil-restricted CEACAM3 (CD66d) receptor."
    McCaw S.E., Schneider J., Liao E.H., Zimmermann W., Gray-Owen S.D.
    Mol. Microbiol. 49:623-637(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, PHOSPHORYLATION, MUTAGENESIS OF TYR-230 AND TYR-241.
  9. "Granulocyte CEACAM3 is a phagocytic receptor of the innate immune system that mediates recognition and elimination of human-specific pathogens."
    Schmitter T., Agerer F., Peterson L., Muenzner P., Hauck C.R.
    J. Exp. Med. 199:35-46(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF TYR-230 AND TYR-241.

Entry informationi

Entry nameiCEAM3_HUMAN
AccessioniPrimary (citable) accession number: P40198
Secondary accession number(s): G5E978, Q3KPH9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: December 16, 2008
Last modified: May 11, 2016
This is version 142 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

This is not the ortholog of rat CEACAM3.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.