P40198 (CEAM3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Carcinoembryonic antigen-related cell adhesion molecule 3 Alternative name(s): Carcinoembryonic antigen CGM1 CD_antigen=CD66d | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 252 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis. Ref.8 Ref.9 |
| Subunit structure | Interacts with S100A9/calprotectin. This interaction is calcium-dependent, but independent of CEACAM3 phosphorylation. Ref.7 |
| Subcellular location | |
| Tissue specificity | CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, prostate, small intestine, heart, lung and kidney. Ref.7 |
| Domain | The cytosolic domain is involved in S100A9 interaction. |
| Post-translational modification | Tyrosine-phosphorylated in response to microbial binding. Tyr-230 and Tyr-241 are both required for phosphorylation to be detected. Ref.8 |
| Sequence similarities | Belongs to the immunoglobulin superfamily. CEA family. Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Caution | This is not the ortholog of rat CEACAM3. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Signal Transmembrane Transmembrane helix |
| PTM | Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P40198-1) Also known as: CGM1A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P40198-2) Also known as: CGM1B; The sequence of this isoform differs from the canonical sequence as follows: 142-252: QENAPGLPVG...RMDHKAEVAS → PELPKPSISS...EPEIHSTTCL | ||||||
| Isoform 3 (identifier: P40198-3) Also known as: CGM1C; The sequence of this isoform differs from the canonical sequence as follows: 182-252: TSIQRDLKEQ...RMDHKAEVAS → PWSLPQLCLLDVPSLHCLGPPTQPQDSSFHL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 34 | 34 | By similarity | ||||||
| Chain | 35 – 252 | 218 | Carcinoembryonic antigen-related cell adhesion molecule 3 | PRO_0000014565 | |||||
Regions | |||||||||
| Topological domain | 35 – 155 | 121 | Extracellular Potential | ||||||
| Transmembrane | 156 – 176 | 21 | Helical; Potential | ||||||
| Topological domain | 177 – 252 | 76 | Cytoplasmic Potential | ||||||
| Domain | 35 – 142 | 108 | Ig-like V-type | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 104 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 111 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 142 – 252 | 111 | QENAP…AEVAS → PELPKPSISSNNSNPKEDKD AVAFTCEPEIHSTTCL in isoform 2. | VSP_002486 | |||||
| Alternative sequence | 182 – 252 | 71 | TSIQR…AEVAS → PWSLPQLCLLDVPSLHCLGP PTQPQDSSFHL in isoform 3. | VSP_002487 | |||||
| Natural variant | 7 | 1 | S → P. Ref.1 Corresponds to variant rs1041999 [ dbSNP | Ensembl ]. | VAR_003905 | |||||
Experimental info | |||||||||
| Mutagenesis | 230 | 1 | Y → F: Loss of phosphorylation and 30% reduction in bacterial uptake. More than 60% reduction in bacterial uptake and loss of RAC1 stimulation; when associated with F-241. Ref.8 Ref.9 | ||||||
| Mutagenesis | 241 | 1 | Y → F: Loss of phosphorylation and 30% reduction in bacterial uptake. More than 60% reduction in bacterial uptake and loss of RAC1 stimulation; when associated with F-230. Ref.8 Ref.9 | ||||||
| Sequence conflict | 49 | 1 | K → N in BAA14321. Ref.1 | ||||||
| Sequence conflict | 84 | 1 | I → T in BAA14322. Ref.1 | ||||||
| Sequence conflict | 137 | 1 | Q → H in BAA14322. Ref.1 | ||||||
| Sequence conflict | 215 | 1 | T → S in AAA51969. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of nonspecific cross-reacting antigens in human granulocytes." Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Misumi Y., Nakazato H., Matsuoka Y. J. Biol. Chem. 266:11810-11817(1991) [PubMed: 2050678] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT PRO-7. Tissue: Leukocyte. |
| [2] | "Genomic organization, splice variants and expression of CGM1, a CD66-related member of the carcinoembryonic antigen gene family." Nagel G., Grunert F., Kuijpers T.W., Watt S.M., Thompson J., Zimmermann W.A. Eur. J. Biochem. 214:27-35(1993) [PubMed: 8508798] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3). |
| [3] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed: 15057824] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "Identification of three new genes and estimation of the size of the carcinoembryonic antigen family." Khan W.N., Fraengsmyr L., Teglund S., Israelsson A., Bremer K., Hammarstroem S. Genomics 14:384-390(1992) [PubMed: 1427854] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 35-141. |
| [7] | "The microbial receptor CEACAM3 is linked to the calprotectin complex in granulocytes." Streichert T., Ebrahimnejad A., Ganzer S., Flayeh R., Wagener C., Bruemmer J. Biochem. Biophys. Res. Commun. 289:191-197(2001) [PubMed: 11708798] [Abstract] Cited for: INTERACTION WITH S100A9, TISSUE SPECIFICITY. |
| [8] | "Immunoreceptor tyrosine-based activation motif phosphorylation during engulfment of Neisseria gonorrhoeae by the neutrophil-restricted CEACAM3 (CD66d) receptor." McCaw S.E., Schneider J., Liao E.H., Zimmermann W., Gray-Owen S.D. Mol. Microbiol. 49:623-637(2003) [PubMed: 12864848] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION, MUTAGENESIS OF TYR-230 AND TYR-241. |
| [9] | "Granulocyte CEACAM3 is a phagocytic receptor of the innate immune system that mediates recognition and elimination of human-specific pathogens." Schmitter T., Agerer F., Peterson L., Muenzner P., Hauck C.R. J. Exp. Med. 199:35-46(2004) [PubMed: 14707113] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF TYR-230 AND TYR-241. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D90277 mRNA. Translation: BAA14321.1. D90278 mRNA. Translation: BAA14322.1. L00692 mRNA. Translation: AAA51969.1. L00693 mRNA. Translation: AAA51970.1. AC022516 Genomic DNA. No translation available. CH471126 Genomic DNA. Translation: EAW57063.1. BC106728 mRNA. Translation: AAI06729.1. |
| IPI | IPI00027411. IPI00289794. IPI00411778. |
| PIR | C40428. S33323. S33324. |
| RefSeq | NP_001806.2. NM_001815.2. |
| UniGene | Hs.11. |
3D structure databases | |
| ProteinModelPortal | P40198. |
| SMR | P40198. Positions 34-141. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P40198. |
PTM databases | |
| PhosphoSite | P40198. |
Polymorphism databases | |
| DMDM | 218511974. |
Proteomic databases | |
| PRIDE | P40198. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000357396; ENSP00000349971; ENSG00000170956. |
| GeneID | 1084. |
| KEGG | hsa:1084. |
| UCSC | uc010eia.1. human. |
Organism-specific databases | |
| CTD | 1084. |
| GeneCards | GC19P042300. |
| H-InvDB | HIX0202914. |
| HGNC | HGNC:1815. CEACAM3. |
| HPA | HPA011041. |
| MIM | 609142. gene. |
| neXtProt | NX_P40198. |
| PharmGKB | PA26359. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | maNOG23108. |
| HOGENOM | HBG505999. |
| HOVERGEN | HBG007922. |
| InParanoid | P40198. |
| OMA | CEPEIHS. |
| OrthoDB | EOG4M0F2K. |
| PhylomeDB | P40198. |
Gene expression databases | |
| ArrayExpress | P40198. |
| Bgee | P40198. |
| CleanEx | HS_CEACAM3. |
| Genevestigator | P40198. |
| GermOnline | ENSG00000170956. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR013783. Ig-like_fold. IPR003599. Ig_sub. IPR013106. Ig_V-set. [Graphical view] |
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 1 hit. |
| KO | K06499. |
| Pfam | PF07686. V-set. 1 hit. [Graphical view] |
| SMART | SM00409. IG. 1 hit. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | CEAM3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P40198 Secondary accession number(s): Q3KPH9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with