P39087 (GRIK2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glutamate receptor, ionotropic kainate 2 Alternative name(s): Glutamate receptor 6 Short name=GluR-6 Short name=GluR6 Glutamate receptor beta-2 Short name=GluR beta-2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 908 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. May be involved in the transmission of light information from the retina to the hypothalamus. Modulates cell surface expression of NETO2. Ref.6 |
| Subunit structure | Homotetramer or heterotetramer of pore-forming glutamate receptor subunits. Tetramers may be formed by the dimerization of dimers Probable. Assembles into a kainate-gated homomeric channel that does not bind AMPA. GRIK2 associated to GRIK5 forms functional channels that can be gated by AMPA. Interacts with DLG4 By similarity. Interacts (via C-terminus) with KLHL17 (via kelch repeats); the interaction targets GRIK2 for degradation via ubiquitin-proteasome pathway By similarity. Interacts with NETO2. Ref.6 |
| Subcellular location | Cell membrane; Multi-pass membrane protein. Cell junction › synapse › postsynaptic cell membrane; Multi-pass membrane protein. |
| Tissue specificity | Most abundant in the cerebellum and the hypothalamus. |
| Developmental stage | Expressed during brain development. Expression drops in the adult. |
| Post-translational modification | Sumoylation mediates kainate receptor-mediated endocytosis and regulates synaptic transmission. Sumoylation is enhanced by PIAS3 and desumoylated by SENP1 By similarity. Ubiquitinated. Ubiquitination regulates the GRIK2 levels at the synapse by leading kainate receptor degradation through proteasome By similarity. |
| Miscellaneous | The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds domoate > kainate > quisqualate > 6-cyano-7-nitroquinoxaline-2,3-dione > L-glutamate = 6,7-dinitroquinoxaline-2,3-dione > dihydrokainate By similarity. |
| Sequence similarities | Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK2 subfamily. [View classification] |
| RNA editing | Edited at positions 567, 571 and 621. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform GluR6 Beta2 (identifier: P39087-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform GluR6-2 (identifier: P39087-2) The sequence of this isoform differs from the canonical sequence as follows: 855-908: RSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKETMA → ESSIWLVPPYHPDTV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 31 | 31 | Potential | ||||||
| Chain | 32 – 908 | 877 | Glutamate receptor, ionotropic kainate 2 | PRO_0000011545 | |||||
Regions | |||||||||
| Topological domain | 32 – 561 | 530 | Extracellular Potential | ||||||
| Transmembrane | 562 – 582 | 21 | Helical; Potential | ||||||
| Topological domain | 583 – 638 | 56 | Cytoplasmic Potential | ||||||
| Transmembrane | 639 – 659 | 21 | Helical; Potential | ||||||
| Topological domain | 660 – 819 | 160 | Extracellular Potential | ||||||
| Transmembrane | 820 – 840 | 21 | Helical; Potential | ||||||
| Topological domain | 841 – 908 | 68 | Cytoplasmic Potential | ||||||
| Region | 516 – 518 | 3 | Glutamate binding By similarity | ||||||
| Region | 689 – 690 | 2 | Glutamate binding By similarity | ||||||
Sites | |||||||||
| Binding site | 523 | 1 | Glutamate By similarity | ||||||
| Binding site | 738 | 1 | Glutamate By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 67 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 73 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 275 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 378 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 412 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 423 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 430 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 546 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Cross-link | 886 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 855 – 908 | 54 | RSFCS…KETMA → ESSIWLVPPYHPDTV in isoform GluR6-2. | VSP_000133 | |||||
| Natural variant | 567 | 1 | I → V in RNA edited version. | ||||||
| Natural variant | 571 | 1 | Y → C in RNA edited version. | ||||||
| Natural variant | 621 | 1 | Q → R in RNA edited version. | ||||||
Experimental info | |||||||||
| Sequence conflict | 611 | 1 | S → G in CAA46907. Ref.1 | ||||||
| Sequence conflict | 849 – 864 | 16 | NAQLE…AMVEE → TLNWKRGPSVAPWWKN in BAA00943. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression and novel subunit isoforms of glutamate receptor genes GluR5 and GluR6." Gregor P., O'Hara B.F., Yang X., Uhl G.R. NeuroReport 4:1343-1346(1993) [PubMed: 8260617] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM GLUR6-2). Strain: BALB/c. Tissue: Brain. |
| [2] | "Cloning and functional expression of a cDNA encoding the mouse beta 2 subunit of the kainate-selective glutamate receptor channel." Morita T., Sakimura K., Kushiya E., Yamazaki M., Meguro H., Araki K., Abe T., Mori K.J., Mishina M. Brain Res. Mol. Brain Res. 14:143-146(1992) [PubMed: 1379666] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-864 (ISOFORM GLUR6-2). |
| [3] | "Q/R site editing in kainate receptor GluR5 and GluR6 pre-mRNAs requires distant intronic sequences." Herb A., Higuchi M., Sprengel R., Seeburg P.H. Proc. Natl. Acad. Sci. U.S.A. 93:1875-1880(1996) [PubMed: 8700852] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 584-695, RNA EDITING OF POSITION 621. Strain: BALB/c. |
| [4] | "Determinants of Ca2+ permeability in both TM1 and TM2 of high affinity kainate receptor channels: diversity by RNA editing." Koehler M., Burnashev N., Sakmann B., Seeburg P.H. Neuron 10:491-500(1993) [PubMed: 7681676] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 560-585, RNA EDITING OF POSITIONS 567; 571 AND 621. Tissue: Brain. |
| [5] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 855-908. Strain: C57BL/6J. |
| [6] | "A transmembrane accessory subunit that modulates kainate-type glutamate receptors." Zhang W., St-Gelais F., Grabner C.P., Trinidad J.C., Sumioka A., Morimoto-Tomita M., Kim K.S., Straub C., Burlingame A.L., Howe J.R., Tomita S. Neuron 61:385-396(2009) [PubMed: 19217376] [Abstract] Cited for: FUNCTION, INTERACTION WITH NETO2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X66117 mRNA. Translation: CAA46907.1. D10054 mRNA. Translation: BAA00943.1. U31443 Genomic DNA. Translation: AAA85221.1. AC113305 Genomic DNA. No translation available. |
| IPI | IPI00131566. IPI00223171. |
| PIR | A43954. S35792. |
| UniGene | Mm.332838. |
3D structure databases | |
| ProteinModelPortal | P39087. |
| SMR | P39087. Positions 33-415, 424-804. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P39087. 4 interactions. |
| STRING | P39087. |
PTM databases | |
| PhosphoSite | P39087. |
Proteomic databases | |
| PRIDE | P39087. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000078692; ENSMUSP00000077758; ENSMUSG00000056073. ENSMUST00000079751; ENSMUSP00000078687; ENSMUSG00000056073. ENSMUST00000105485; ENSMUSP00000101125; ENSMUSG00000056073. ENSMUST00000105487; ENSMUSP00000101127; ENSMUSG00000056073. |
Organism-specific databases | |
| MGI | MGI:95815. Grik2. |
Phylogenomic databases | |
| GeneTree | ENSGT00590000083056. |
| HOGENOM | HBG381523. |
| HOVERGEN | HBG051839. |
| InParanoid | P39087. |
| OMA | GVQQFPQ. |
| OrthoDB | EOG41C6VH. |
| PhylomeDB | P39087. |
Gene expression databases | |
| ArrayExpress | P39087. |
| Bgee | P39087. |
| Genevestigator | P39087. |
| GermOnline | ENSMUSG00000056073. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001828. ANF_lig-bd_rcpt. IPR019594. Glu_rcpt_Glu/Gly-bd. IPR001320. Iontro_glu_rcpt. IPR001508. NMDA_rcpt. [Graphical view] |
| Pfam | PF01094. ANF_receptor. 1 hit. PF00060. Lig_chan. 1 hit. PF10613. Lig_chan-Glu_bd. 1 hit. [Graphical view] |
| PRINTS | PR00177. NMDARECEPTOR. |
| SMART | SM00918. Lig_chan-Glu_bd. 1 hit. SM00079. PBPe. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | GRIK2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P39087 Secondary accession number(s): Q60933 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with