Reviewed,
UniProtKB/Swiss-Prot P39060 (COIA1_HUMAN)
Last modified
November 25, 2008.
Version 96.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Collagen alpha-1(XVIII) chain Cleaved into the following chain: 1- Recommended name: Endostatin | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1754 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube. Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling. |
| Subcellular location | Secreted › extracellular space › extracellular matrixBy similarity. |
| Tissue specificity | Present in multiple organs with highest levels in liver, lung and kidney. |
| Post-translational modification | Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains. |
| Polymorphism | There is an association between a polymorphism in position 1675 and prostate cancer. Heterozygous Asn-1675 individuals have a 2.5 times increased chance of developing prostate cancer as compared with homozygous Asp-1675 individuals. |
| Involvement in disease | Defects in COL18A1 are a cause of Knobloch syndrome (KNO) [MIM:267750]. KNO is an autosomal recessive disorder defined by the occurrence of high myopia, vitreoretinal degeneration with retinal detachment, macular abnormalities and occipital encephalocele. |
| Sequence similarities | Belongs to the multiplexin collagen family. Contains 1 FZ (frizzled) domain. Contains 1 TSP N-terminal (TSPN) domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P39060-3) Also known as: NC1-728; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Notes: Produced by alternative promoter usage. | ||||||
| Isoform 2 (identifier: P39060-1) Also known as: Long; NC-493; The sequence of this isoform differs from the canonical sequence as follows: 216-450: Missing. | ||||||
| Notes: Produced by alternative splicing of isoform 1. | ||||||
| Isoform 3 (identifier: P39060-2) Also known as: Short; NC1-303; The sequence of this isoform differs from the canonical sequence as follows: 1-415: Missing. 416-450: QDACWSRLGGGRLPVACASLPTQEDGYCVLIGPAA → MAPRCPWPWPRRRRLLDVLAPLVLLLGVRAASAEP | ||||||
| Notes: Produced by alternative promoter usage. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | |||||||||||||||||||||||||||||||||||
| Chain | 24 – 1754 | 1731 | Collagen alpha-1(XVIII) chain | PRO_0000005793 | ||||||||||||||||||||||||||||||||||
| Chain | 1572 – 1754 | 183 | Endostatin | PRO_0000005794 | ||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||
| Domain | 329 – 446 | 118 | FZ | |||||||||||||||||||||||||||||||||||
| Domain | 456 – 644 | 189 | TSP N-terminal | |||||||||||||||||||||||||||||||||||
| Region | 645 – 751 | 107 | Nonhelical region 1 (NC1) | |||||||||||||||||||||||||||||||||||
| Region | 752 – 785 | 34 | Triple-helical region 1 (COL1) | |||||||||||||||||||||||||||||||||||
| Region | 786 – 795 | 10 | Nonhelical region 2 (NC2) | |||||||||||||||||||||||||||||||||||
| Region | 796 – 875 | 80 | Triple-helical region 2 (COL2) | |||||||||||||||||||||||||||||||||||
| Region | 876 – 899 | 24 | Nonhelical region 3 (NC3) | |||||||||||||||||||||||||||||||||||
| Region | 900 – 1021 | 122 | Triple-helical region 3 (COL3) | |||||||||||||||||||||||||||||||||||
| Region | 1022 – 1044 | 23 | Nonhelical region 4 (NC4) | |||||||||||||||||||||||||||||||||||
| Region | 1045 – 1127 | 83 | Triple-helical region 4 (COL4) | |||||||||||||||||||||||||||||||||||
| Region | 1128 – 1141 | 14 | Nonhelical region 5 (NC5) | |||||||||||||||||||||||||||||||||||
| Region | 1142 – 1183 | 42 | Triple-helical region 5 (COL5) | |||||||||||||||||||||||||||||||||||
| Region | 1184 – 1196 | 13 | Nonhelical region 6 (NC6) | |||||||||||||||||||||||||||||||||||
| Region | 1197 – 1269 | 73 | Triple-helical region 6 (COL6) | |||||||||||||||||||||||||||||||||||
| Region | 1270 – 1279 | 10 | Nonhelical region 7 (NC7) | |||||||||||||||||||||||||||||||||||
| Region | 1280 – 1312 | 33 | Triple-helical region 7 (COL7) | |||||||||||||||||||||||||||||||||||
| Region | 1313 – 1324 | 12 | Nonhelical region 8 (NC8) | |||||||||||||||||||||||||||||||||||
| Region | 1325 – 1346 | 22 | Triple-helical region 8 (COL8) | |||||||||||||||||||||||||||||||||||
| Region | 1347 – 1353 | 7 | Nonhelical region 9 (NC9) | |||||||||||||||||||||||||||||||||||
| Region | 1354 – 1411 | 58 | Triple-helical region 9 (COL9) | |||||||||||||||||||||||||||||||||||
| Region | 1412 – 1424 | 13 | Nonhelical region 10 (NC10) | |||||||||||||||||||||||||||||||||||
| Region | 1425 – 1442 | 18 | Triple-helical region 10 (COL10) | |||||||||||||||||||||||||||||||||||
| Region | 1443 – 1754 | 312 | Nonhelical region 11 (NC11) | |||||||||||||||||||||||||||||||||||
| Motif | 1330 – 1332 | 3 | Cell attachment site Potential | |||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||
| Metal binding | 1572 | 1 | Zinc | |||||||||||||||||||||||||||||||||||
| Metal binding | 1574 | 1 | Zinc | |||||||||||||||||||||||||||||||||||
| Metal binding | 1582 | 1 | Zinc | |||||||||||||||||||||||||||||||||||
| Metal binding | 1647 | 1 | Zinc | |||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||
| Glycosylation | 68 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||
| Glycosylation | 129 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||
| Glycosylation | 164 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||
| Glycosylation | 926 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||
| Glycosylation | 1567 | 1 | O-linked (GalNAc...) | CAR_000150 | ||||||||||||||||||||||||||||||||||
| Disulfide bond | 334 ↔ 397 | By similarity | ||||||||||||||||||||||||||||||||||||
| Disulfide bond | 344 ↔ 390 | By similarity | ||||||||||||||||||||||||||||||||||||
| Disulfide bond | 381 ↔ 419 | By similarity | ||||||||||||||||||||||||||||||||||||
| Disulfide bond | 408 ↔ 443 | By similarity | ||||||||||||||||||||||||||||||||||||
| Disulfide bond | 412 ↔ 432 | By similarity | ||||||||||||||||||||||||||||||||||||
| Disulfide bond | 1604 ↔ 1744 | By similarity | ||||||||||||||||||||||||||||||||||||
| Disulfide bond | 1706 ↔ 1736 | By similarity | ||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 415 | 415 | Missing in isoform 3. | VSP_023130 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 216 – 450 | 235 | Missing in isoform 2. | VSP_023131 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 416 – 450 | 35 | QDACW…IGPAA → MAPRCPWPWPRRRRLLDVLA PLVLLLGVRAASAEP in isoform 3. | VSP_023132 | ||||||||||||||||||||||||||||||||||
| Natural variant | 49 | 1 | Q → L | VAR_018053 | ||||||||||||||||||||||||||||||||||
| Natural variant | 111 | 1 | G → R | VAR_018054 | ||||||||||||||||||||||||||||||||||
| Natural variant | 1076 | 1 | V → I | VAR_018055 | ||||||||||||||||||||||||||||||||||
| Natural variant | 1121 | 1 | P → R | VAR_018056 | ||||||||||||||||||||||||||||||||||
| Natural variant | 1675 | 1 | D → N Decreased activity for binding laminin; increased risk of developing prostate cancer; in compound heterozygotes may cause Knobloch syndrome when in combination with a frameshift/truncating mutation. | VAR_012709 | ||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 299 | 1 | R → K in AAR83296. Ref.2 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 663 | 1 | S → F in AAC39658 and AAC39659. Ref.1 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1112 | 1 | V → L in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1147 | 1 | P → R in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1168 | 1 | R → L in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1210 | 1 | P → L in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1299 | 1 | A → P in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1319 | 1 | L → K in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1355 | 1 | P → A in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1358 | 1 | P → A in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1362 – 1364 | 3 | Missing in AAC39658 and AAC39659. Ref.1 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1362 – 1364 | 3 | Missing in AAR83296, AAR83297 and AAR83298. Ref.2 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1362 – 1364 | 3 | Missing in AAH33715 and AAH63833. Ref.4 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1362 – 1364 | 3 | Missing in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1444 | 1 | G → GQ in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1542 | 1 | R → G in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1552 | 1 | A → G in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1561 – 1562 | 2 | LR → CG in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1681 | 1 | R → T in AAF01310. Ref.7 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1685 | 1 | W → R in AAK50626. Ref.8 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1721 | 1 | S → Y in AAF01310. Ref.7 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1736 | 1 | C → S in AAK50626. Ref.8 | |||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 1343 – 1347 | 5 | ||||||||||||||||||||||||||||||||||||
| Helix | 1359 – 1372 | 14 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1379 – 1383 | 5 | ||||||||||||||||||||||||||||||||||||
| Helix | 1391 – 1393 | 3 | ||||||||||||||||||||||||||||||||||||
| Helix | 1396 – 1398 | 3 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1411 – 1414 | 4 | ||||||||||||||||||||||||||||||||||||
| Helix | 1416 – 1419 | 4 | ||||||||||||||||||||||||||||||||||||
| Helix | 1441 – 1443 | 3 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1451 – 1453 | 3 | ||||||||||||||||||||||||||||||||||||
| Helix | 1468 – 1471< | |||||||||||||||||||||||||||||||||||||

Clusters with