P39060 (COIA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 145.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Collagen alpha-1(XVIII) chain Cleaved into the following chain: | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1754 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube. Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling. |
| Subcellular location | Secreted › extracellular space › extracellular matrix By similarity. |
| Tissue specificity | Present in multiple organs with highest levels in liver, lung and kidney. |
| Post-translational modification | Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains. |
| Polymorphism | There is an association between a polymorphism in position 1675 and prostate cancer. Heterozygous Asn-1675 individuals have a 2.5 times increased chance of developing prostate cancer as compared with homozygous Asp-1675 individuals. |
| Involvement in disease | Knobloch syndrome 1 (KNO1) [MIM:267750]: A developmental disorder primarily characterized by typical eye abnormalities, including high myopia, cataracts, dislocated lens, vitreoretinal degeneration, and retinal detachment, with occipital skull defects, which can range from occipital encephalocele to occult cutis aplasia. |
| Sequence similarities | Belongs to the multiplexin collagen family. Contains 1 FZ (frizzled) domain. Contains 1 laminin G-like domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 6 | EBI-981314,EBI-981314 | ||
| APP | P05067 | 2 | EBI-2566375,EBI-821758 | |
| NCL | P19338 | 12 | EBI-2566375,EBI-346967 | |
| TGM2 | P21980 | 2 | EBI-2566375,EBI-727668 |
Alternative products
| This entry describes 3 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P39060-3) Also known as: NC1-728; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform 2 (identifier: P39060-1) Also known as: Long; NC-493; The sequence of this isoform differs from the canonical sequence as follows: 216-450: Missing. | ||||||
| Note: Produced by alternative splicing of isoform 1. | ||||||
| Isoform 3 (identifier: P39060-2) Also known as: Short; NC1-303; The sequence of this isoform differs from the canonical sequence as follows: 1-415: Missing. 416-450: QDACWSRLGGGRLPVACASLPTQEDGYCVLIGPAA → MAPRCPWPWPRRRRLLDVLAPLVLLLGVRAASAEP | ||||||
| Note: Produced by alternative promoter usage. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 24 – 1754 | 1731 | Collagen alpha-1(XVIII) chain | PRO_0000005793 | ||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 1572 – 1754 | 183 | Endostatin | PRO_0000005794 | ||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 329 – 446 | 118 | FZ | |||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 456 – 644 | 189 | Laminin G-like | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 645 – 751 | 107 | Nonhelical region 1 (NC1) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 752 – 785 | 34 | Triple-helical region 1 (COL1) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 786 – 795 | 10 | Nonhelical region 2 (NC2) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 796 – 875 | 80 | Triple-helical region 2 (COL2) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 876 – 899 | 24 | Nonhelical region 3 (NC3) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 900 – 1021 | 122 | Triple-helical region 3 (COL3) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1022 – 1044 | 23 | Nonhelical region 4 (NC4) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1045 – 1127 | 83 | Triple-helical region 4 (COL4) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1128 – 1141 | 14 | Nonhelical region 5 (NC5) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1142 – 1183 | 42 | Triple-helical region 5 (COL5) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1184 – 1196 | 13 | Nonhelical region 6 (NC6) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1197 – 1269 | 73 | Triple-helical region 6 (COL6) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1270 – 1279 | 10 | Nonhelical region 7 (NC7) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1280 – 1312 | 33 | Triple-helical region 7 (COL7) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1313 – 1324 | 12 | Nonhelical region 8 (NC8) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1325 – 1346 | 22 | Triple-helical region 8 (COL8) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1347 – 1353 | 7 | Nonhelical region 9 (NC9) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1354 – 1411 | 58 | Triple-helical region 9 (COL9) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1412 – 1424 | 13 | Nonhelical region 10 (NC10) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1425 – 1442 | 18 | Triple-helical region 10 (COL10) | |||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1443 – 1754 | 312 | Nonhelical region 11 (NC11) | |||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 1330 – 1332 | 3 | Cell attachment site Potential | |||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 1572 | 1 | Zinc | |||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 1574 | 1 | Zinc | |||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 1582 | 1 | Zinc | |||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 1647 | 1 | Zinc | |||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 68 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 129 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 164 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 926 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 1567 | 1 | O-linked (GalNAc...) | CAR_000150 | ||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 334 ↔ 397 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 344 ↔ 390 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 381 ↔ 419 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 408 ↔ 443 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 412 ↔ 432 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 1604 ↔ 1744 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 1706 ↔ 1736 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 415 | 415 | Missing in isoform 3. | VSP_023130 | ||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 216 – 450 | 235 | Missing in isoform 2. | VSP_023131 | ||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 416 – 450 | 35 | QDACW…IGPAA → MAPRCPWPWPRRRRLLDVLA PLVLLLGVRAASAEP in isoform 3. | VSP_023132 | ||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 49 | 1 | Q → L. Ref.12 | VAR_018053 | ||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 111 | 1 | G → R. Ref.12 | VAR_018054 | ||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 288 | 1 | A → T. Corresponds to variant rs11702494 [ dbSNP | Ensembl ]. | VAR_059232 | ||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 379 | 1 | T → M. Corresponds to variant rs8133886 [ dbSNP | Ensembl ]. | VAR_061115 | ||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1076 | 1 | V → I. Ref.1 Ref.2 Ref.4 Ref.11 Ref.12 | VAR_018055 | ||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1121 | 1 | P → R. Ref.5 Ref.12 Ref.13 | VAR_018056 | ||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1195 | 1 | Q → H. Corresponds to variant rs2230693 [ dbSNP | Ensembl ]. | VAR_059233 | ||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1675 | 1 | D → N Decreased activity for binding laminin; increased risk of developing prostate cancer; in compound heterozygotes may cause Knobloch syndrome when in combination with a frameshift/truncating mutation. Ref.2 Ref.7 Ref.11 Ref.12 | VAR_012709 | ||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 299 | 1 | R → K in AAR83296. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 663 | 1 | S → F in AAC39658. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 663 | 1 | S → F in AAC39659. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1112 | 1 | V → L in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1147 | 1 | P → R in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1168 | 1 | R → L in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1210 | 1 | P → L in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1299 | 1 | A → P in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1319 | 1 | L → K in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1355 | 1 | P → A in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1358 | 1 | P → A in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1362 – 1364 | 3 | Missing in AAC39658. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1362 – 1364 | 3 | Missing in AAC39659. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1362 – 1364 | 3 | Missing in AAR83296. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1362 – 1364 | 3 | Missing in AAR83297. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1362 – 1364 | 3 | Missing in AAR83298. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1362 – 1364 | 3 | Missing in AAH33715. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1362 – 1364 | 3 | Missing in AAH63833. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1362 – 1364 | 3 | Missing in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1444 | 1 | G → GQ in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1542 | 1 | R → G in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1552 | 1 | A → G in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1561 – 1562 | 2 | LR → CG in AAA51864. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1681 | 1 | R → T in AAF01310. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1685 | 1 | W → R in AAK50626. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1721 | 1 | S → Y in AAF01310. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1736 | 1 | C → S in AAK50626. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1445 – 1450 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1451 – 1457 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1458 – 1460 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1466 – 1469 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1470 – 1473 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1474 – 1479 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1482 – 1486 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1488 – 1493 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1581 – 1585 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1597 – 1610 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1617 – 1621 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1629 – 1631 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1634 – 1636 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1649 – 1652 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1654 – 1657 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1679 – 1681 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1689 – 1691 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1706 – 1709 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1716 – 1722 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1723 – 1725 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1727 – 1729 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1732 – 1735 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1743 – 1747 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete primary structure of two variant forms of human type XVIII collagen and tissue-specific differences in the expression of the corresponding transcripts." Saarela J., Ylikarppa R., Rehn M., Purmonen S., Pihlajaniemi T. Matrix Biol. 16:319-328(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), VARIANT ILE-1076. |
| [2] | "Characterization of the human type XVIII collagen gene and proteolytic processing and tissue location of the variant containing a frizzled motif." Elamaa H., Snellman A., Rehn M., Autio-Harmainen H., Pihlajaniemi T. Matrix Biol. 22:427-442(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2 AND 3), VARIANTS ILE-1076 AND ASN-1675. |
| [3] | "The DNA sequence of human chromosome 21." Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. Yaspo M.-L.Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ILE-1076. Tissue: Kidney and PNS. |
| [5] | "Cloning of cDNA and genomic DNA encoding human type XVIII collagen and localization of the alpha 1(XVIII) collagen gene to mouse chromosome 10 and human chromosome 21." Oh S.P., Warman M.L., Seldin M.F., Cheng S., Knoll J.H., Timmons S., Olsen B.R. Genomics 19:494-499(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1069-1754, VARIANT ARG-1121. |
| [6] | "Inhibition effect in vitro of purified endostatin expressed in Pichia pastoris." Feng Y., Cui L.B., Liu C.X., Ma Q.J. Sheng Wu Gong Cheng Xue Bao 17:278-282(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1568-1754. |
| [7] | "Cloning and expression of human endostatin gene in Escherichia coli." Zhi-Yong H., Biao L., Wei-Jie Z., Xiang-Fu W. Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1572-1754, VARIANT ASN-1675. Tissue: Placenta. |
| [8] | "Endostatin promotes delayed secondary damage following traumatic brain injury." Deininger M.H., Trautmann K., Schluesener H.J. Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1642-1743. |
| [9] | "Zinc-dependent dimers observed in crystals of human endostatin." Ding Y.-H., Javaherian K., Lo K.-M., Chopra R., Boehm T., Lanciotti J., Harris B.A., Li Y., Shapiro R., Hohenester E., Timpl R., Folkman J., Wiley D.C. Proc. Natl. Acad. Sci. U.S.A. 95:10443-10448(1998) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 1572-1749, ZINC-BINDING SITE. |
| [10] | "Collagen XVIII, containing an endogenous inhibitor of angiogenesis and tumor growth, plays a critical role in the maintenance of retinal structure and in neural tube closure." Sertie A.L., Sossi V., Camargo A.A., Zatz M., Brahe C., Passos-Bueno M.R. Hum. Mol. Genet. 9:2051-2058(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN KNO1. |
| [11] | "A polymorphism in endostatin, an angiogenesis inhibitor, predisposes for the development of prostatic adenocarcinoma." Iughetti P., Suzuki O., Godoi P.H., Alves V.A., Sertie A.L., Zorick T., Soares F., Camargo A.A., Moreira E.S., di Loreto C., Moreira-Filho C.A., Simpson A., Oliva G., Passos-Bueno M.R. Cancer Res. 61:7375-7378(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ILE-1076 AND ASN-1675. |
| [12] | "Knobloch syndrome: novel mutations in COL18A1, evidence for genetic heterogeneity, and a functionally impaired polymorphism in endostatin." Menzel O., Bekkeheien R.C.J., Reymond A., Fukai N., Boye E., Kosztolanyi G., Aftimos S., Deutsch S., Scott H.S., Olsen B.R., Antonarakis S.E., Guipponi M. Hum. Mutat. 23:77-84(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS LEU-49; ARG-111; ILE-1076 AND ARG-1121, CHARACTERIZATION OF VARIANT ASN-1675. |
| [13] | "DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome." Ley T.J., Mardis E.R., Ding L., Fulton B., McLellan M.D., Chen K., Dooling D., Dunford-Shore B.H., McGrath S., Hickenbotham M., Cook L., Abbott R., Larson D.E., Koboldt D.C., Pohl C., Smith S., Hawkins A., Abbott S. Wilson R.K.Nature 456:66-72(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] ARG-1121. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF018081 mRNA. Translation: AAC39658.1. AF018082 mRNA. Translation: AAC39659.1. AY484971 AY484970 Genomic DNA. Translation: AAR83296.1.AY484971 AY484970 Genomic DNA. Translation: AAR83297.1.AY484971 AY484970 Genomic DNA. Translation: AAR83298.1.AL163302 Genomic DNA. Translation: CAB90482.1. BX322561 Genomic DNA. No translation available. BC033715 mRNA. Translation: AAH33715.1. BC063833 mRNA. Translation: AAH63833.1. L22548 mRNA. Translation: AAA51864.1. AF416592 mRNA. Translation: AAL37720.1. AF184060 mRNA. Translation: AAF01310.1. AF333247 mRNA. Translation: AAK50626.1. | ||||||||||||||||||||||||
| IPI | IPI00022822. IPI00414694. IPI00783931. | ||||||||||||||||||||||||
| RefSeq | NP_085059.2. NM_030582.3. NP_569712.2. NM_130445.2. | ||||||||||||||||||||||||
| UniGene | Hs.517356. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | P39060. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | P39060. 13 interactions. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| GlycoSuiteDB | P39060. | ||||||||||||||||||||||||
| PhosphoSite | P39060. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 215274264. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | P39060. | ||||||||||||||||||||||||
| PRIDE | P39060. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000355480; ENSP00000347665; ENSG00000182871. ENST00000359759; ENSP00000352798; ENSG00000182871. ENST00000400337; ENSP00000383191; ENSG00000182871. | ||||||||||||||||||||||||
| GeneID | 80781. | ||||||||||||||||||||||||
| KEGG | hsa:80781. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 80781. | ||||||||||||||||||||||||
| GeneCards | GC21P046825. | ||||||||||||||||||||||||
| HGNC | HGNC:2195. COL18A1. | ||||||||||||||||||||||||
| HPA | CAB001961. HPA011025. | ||||||||||||||||||||||||
| MIM | 120328. gene. 267750. phenotype. | ||||||||||||||||||||||||
| neXtProt | NX_P39060. | ||||||||||||||||||||||||
| Orphanet | 1571. Knobloch syndrome. | ||||||||||||||||||||||||
| PharmGKB | PA26711. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG12793. | ||||||||||||||||||||||||
| HOVERGEN | HBG053241. | ||||||||||||||||||||||||
| InParanoid | P39060. | ||||||||||||||||||||||||
| KO | K06823. | ||||||||||||||||||||||||
| OMA | DCEEFQR. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Pathway_Interaction_DB | hnf3apathway. FOXA1 transcription factor network. | ||||||||||||||||||||||||
| Reactome | REACT_118779. Extracellular matrix organization. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | P39060. | ||||||||||||||||||||||||
| Bgee | P39060. | ||||||||||||||||||||||||
| Genevestigator | P39060. | ||||||||||||||||||||||||
| GermOnline | ENSG00000182871. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 1.10.2000.10. 1 hit. 3.10.100.10. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR016186. C-type_lectin-like. IPR016187. C-type_lectin_fold. IPR026917. COL18A1. IPR008160. Collagen. IPR010515. Collagenase_NC10/endostatin. IPR008985. ConA-like_lec_gl_sf. IPR010363. DUF959_COL18_N. IPR020067. Frizzled_dom. IPR001791. Laminin_G. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR24023:SF130. PTHR24023:SF130. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF01391. Collagen. 7 hits. PF06121. DUF959. 1 hit. PF06482. Endostatin. 1 hit. PF01392. Fz. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00063. FRI. 1 hit. SM00282. LamG. 1 hit. SM00210. TSPN. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF56436. C-type_lectin_fold. 1 hit. SSF49899. ConA_like_lec_gl. 1 hit. SSF63501. Frizzled_Cys-rich. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS50038. FZ. 1 hit. PS50025. LAM_G_DOMAIN. False negative. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | COL18A1. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | P39060. | ||||||||||||||||||||||||
| GenomeRNAi | 80781. | ||||||||||||||||||||||||
| NextBio | 71187. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | COIA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P39060 Secondary accession number(s): A8MVI4 Q9Y6Q8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
