Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger E-box-binding homeobox 1

Gene

ZEB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a transcriptional repressor. Inhibits interleukin-2 (IL-2) gene expression. Enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and on the cell type. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. Represses RCOR1 transcription activation during neurogenesis. Represses transcription by binding to the E box (5'-CANNTG-3'). Promotes tumorigenicity by repressing stemness-inhibiting microRNAs.3 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri170 – 19324C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri200 – 22223C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri240 – 26223C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri268 – 29225C2H2-type 4; atypicalPROSITE-ProRule annotationAdd
BLAST
DNA bindingi581 – 64060Homeobox; atypicalAdd
BLAST
Zinc fingeri904 – 92623C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri932 – 95423C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri960 – 98122C2H2-type 7; atypicalPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • chromatin binding Source: Ensembl
  • E-box binding Source: UniProtKB
  • transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding Source: HGNC
  • transcription coactivator activity Source: ProtInc
  • transcription corepressor activity Source: ProtInc
  • transcription factor activity, sequence-specific DNA binding Source: ProtInc
  • zinc ion binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Differentiation, Neurogenesis, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

SignaLinkiP37275.
SIGNORiP37275.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger E-box-binding homeobox 1
Alternative name(s):
NIL-2-A zinc finger protein
Negative regulator of IL2
Transcription factor 8
Short name:
TCF-8
Gene namesi
Name:ZEB1
Synonyms:AREB6, TCF8
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:11642. ZEB1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • transcription factor complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Corneal dystrophy, posterior polymorphous, 3 (PPCD3)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA subtype of posterior corneal dystrophy, a disease characterized by alterations of Descemet membrane presenting as vesicles, opacities or band-like lesions on slit-lamp examination and specular microscopy. Affected patient typically are asymptomatic.
See also OMIM:609141
Corneal dystrophy, Fuchs endothelial, 6 (FECD6)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA corneal disease caused by loss of endothelium of the central cornea. It is characterized by focal wart-like guttata that arise from Descemet membrane and develop in the central cornea, epithelial blisters, reduced vision and pain. Descemet membrane is thickened by abnormal collagenous deposition.
See also OMIM:613270
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti78 – 781N → T in FECD6; no effect on protein expression; no effect on nuclear localization. 3 Publications
Corresponds to variant rs80194531 [ dbSNP | Ensembl ].
VAR_063759
Natural varianti525 – 5251G → E Found in a patient with FECD6. 1 Publication
VAR_072897
Natural varianti640 – 6401Q → H in FECD6; down-regulation of several collagen genes expression. 1 Publication
Corresponds to variant rs779148597 [ dbSNP | Ensembl ].
VAR_072898
Natural varianti649 – 6491P → A in FECD6; no effect on protein expression; no effect on nuclear localization. 2 Publications
Corresponds to variant rs781750314 [ dbSNP | Ensembl ].
VAR_063760
Natural varianti696 – 6961N → S in FECD6; no effect on protein expression; no effect on nuclear localization. 1 Publication
Corresponds to variant rs567252241 [ dbSNP | Ensembl ].
VAR_072899
Natural varianti810 – 8101Q → P in FECD6; no effect on protein expression; no effect on nuclear localization. 2 Publications
Corresponds to variant rs199944415 [ dbSNP | Ensembl ].
VAR_063761
Natural varianti840 – 8401Q → P in FECD6; no effect on protein expression; no effect on nuclear localization. 2 Publications
Corresponds to variant rs118020901 [ dbSNP | Ensembl ].
VAR_063762
Natural varianti905 – 9051A → G in FECD6; no effect on protein expression; no effect on nuclear localization. 1 Publication
Corresponds to variant rs78449005 [ dbSNP | Ensembl ].
VAR_072900
Natural varianti905 – 9051A → T in FECD6. 1 Publication
VAR_063763

Keywords - Diseasei

Corneal dystrophy, Disease mutation

Organism-specific databases

MalaCardsiZEB1.
MIMi609141. phenotype.
613270. phenotype.
Orphaneti98974. Fuchs endothelial corneal dystrophy.
98973. Posterior polymorphous corneal dystrophy.
PharmGKBiPA162409589.

Polymorphism and mutation databases

BioMutaiZEB1.
DMDMi6166575.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11241124Zinc finger E-box-binding homeobox 1PRO_0000047231Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei31 – 311PhosphoserineBy similarity
Modified residuei33 – 331PhosphoserineBy similarity
Modified residuei313 – 3131PhosphoserineBy similarity
Modified residuei322 – 3221PhosphoserineCombined sources
Cross-linki347 – 347Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
Cross-linki493 – 493Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki504 – 504Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki515 – 515Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei642 – 6421PhosphoserineCombined sources
Modified residuei679 – 6791PhosphoserineCombined sources
Modified residuei686 – 6861PhosphoserineBy similarity
Modified residuei693 – 6931PhosphoserineBy similarity
Modified residuei700 – 7001PhosphoserineBy similarity
Modified residuei702 – 7021PhosphothreonineCombined sources
Modified residuei704 – 7041PhosphoserineBy similarity
Cross-linki774 – 774Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP37275.
MaxQBiP37275.
PaxDbiP37275.
PeptideAtlasiP37275.
PRIDEiP37275.

PTM databases

iPTMnetiP37275.
PhosphoSiteiP37275.

Expressioni

Tissue specificityi

Colocalizes with SMARCA4/BRG1 in E-cadherin-negative cells from established lines, and stroma of normal colon as well as in de-differentiated epithelial cells at the invasion front of colorectal carcinomas (at protein level). Expressed in heart and skeletal muscle, but not in liver, spleen, or pancreas.1 Publication

Gene expression databases

BgeeiENSG00000148516.
CleanExiHS_ZEB1.
ExpressionAtlasiP37275. baseline and differential.
GenevisibleiP37275. HS.

Organism-specific databases

HPAiCAB058686.
HPA027524.

Interactioni

Subunit structurei

Interacts (via N-terminus) with SMARCA4/BRG1.1 Publication

Protein-protein interaction databases

BioGridi112796. 25 interactions.
IntActiP37275. 3 interactions.
MINTiMINT-94525.
STRINGi9606.ENSP00000354487.

Structurei

Secondary structure

1
1124
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi590 – 60011Combined sources
Helixi608 – 61811Combined sources
Helixi622 – 63413Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2E19NMR-A586-642[»]
ProteinModelPortaliP37275.
SMRiP37275. Positions 583-642.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP37275.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi989 – 1124136Glu-rich (acidic)Add
BLAST

Sequence similaritiesi

Contains 7 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 homeobox DNA-binding domain.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri170 – 19324C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri200 – 22223C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri240 – 26223C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri268 – 29225C2H2-type 4; atypicalPROSITE-ProRule annotationAdd
BLAST
Zinc fingeri904 – 92623C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri932 – 95423C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri960 – 98122C2H2-type 7; atypicalPROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Homeobox, Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG3623. Eukaryota.
ENOG410ZFMZ. LUCA.
GeneTreeiENSGT00630000089829.
HOGENOMiHOG000264256.
HOVERGENiHBG004697.
InParanoidiP37275.
KOiK09299.
OMAiECEKPQG.
OrthoDBiEOG091G0F7Y.
PhylomeDBiP37275.
TreeFamiTF331759.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
3.30.160.60. 5 hits.
InterProiIPR008598. Di19_Zn_binding_dom.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
PF05605. zf-Di19. 1 hit.
[Graphical view]
SMARTiSM00389. HOX. 1 hit.
SM00355. ZnF_C2H2. 7 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P37275-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADGPRCKRR KQANPRRNNV TNYNTVVETN SDSDDEDKLH IVEEESVTDA
60 70 80 90 100
ADCEGVPEDD LPTDQTVLPG RSSEREGNAK NCWEDDRKEG QEILGPEAQA
110 120 130 140 150
DEAGCTVKDD ECESDAENEQ NHDPNVEEFL QQQDTAVIFP EAPEEDQRQG
160 170 180 190 200
TPEASGHDEN GTPDAFSQLL TCPYCDRGYK RFTSLKEHIK YRHEKNEDNF
210 220 230 240 250
SCSLCSYTFA YRTQLERHMT SHKSGRDQRH VTQSGCNRKF KCTECGKAFK
260 270 280 290 300
YKHHLKEHLR IHSGEKPYEC PNCKKRFSHS GSYSSHISSK KCISLIPVNG
310 320 330 340 350
RPRTGLKTSQ CSSPSLSASP GSPTRPQIRQ KIENKPLQEQ LSVNQIKTEP
360 370 380 390 400
VDYEFKPIVV ASGINCSTPL QNGVFTGGGP LQATSSPQGM VQAVVLPTVG
410 420 430 440 450
LVSPISINLS DIQNVLKVAV DGNVIRQVLE NNQANLASKE QETINASPIQ
460 470 480 490 500
QGGHSVISAI SLPLVDQDGT TKIIINYSLE QPSQLQVVPQ NLKKENPVAT
510 520 530 540 550
NSCKSEKLPE DLTVKSEKDK SFEGGVNDST CLLCDDCPGD INALPELKHY
560 570 580 590 600
DLKQPTQPPP LPAAEAEKPE SSVSSATGDG NLSPSQPPLK NLLSLLKAYY
610 620 630 640 650
ALNAQPSAEE LSKIADSVNL PLDVVKKWFE KMQAGQISVQ SSEPSSPEPG
660 670 680 690 700
KVNIPAKNND QPQSANANEP QDSTVNLQSP LKMTNSPVLP VGSTTNGSRS
710 720 730 740 750
STPSPSPLNL SSSRNTQGYL YTAEGAQEEP QVEPLDLSLP KQQGELLERS
760 770 780 790 800
TITSVYQNSV YSVQEEPLNL SCAKKEPQKD SCVTDSEPVV NVIPPSANPI
810 820 830 840 850
NIAIPTVTAQ LPTIVAIADQ NSVPCLRALA ANKQTILIPQ VAYTYSTTVS
860 870 880 890 900
PAVQEPPLKV IQPNGNQDER QDTSSEGVSN VEDQNDSDST PPKKKMRKTE
910 920 930 940 950
NGMYACDLCD KIFQKSSSLL RHKYEHTGKR PHECGICKKA FKHKHHLIEH
960 970 980 990 1000
MRLHSGEKPY QCDKCGKRFS HSGSYSQHMN HRYSYCKREA EERDSTEQEE
1010 1020 1030 1040 1050
AGPEILSNEH VGARASPSQG DSDERESLTR EEDEDSEKEE EEEDKEMEEL
1060 1070 1080 1090 1100
QEEKECEKPQ GDEEEEEEEE EVEEEEVEEA ENEGEEAKTE GLMKDDRAES
1110 1120
QASSLGQKVG ESSEQVSEEK TNEA
Length:1,124
Mass (Da):124,074
Last modified:July 15, 1999 - v2
Checksum:i0A2714CC37C848D1
GO
Isoform 2 (identifier: P37275-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-87: R → TG

Note: No experimental confirmation available.
Show »
Length:1,125
Mass (Da):124,076
Checksum:i3C327EEBBA18D19B
GO
Isoform 3 (identifier: P37275-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     20-87: VTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDR → G

Show »
Length:1,057
Mass (Da):116,593
Checksum:i7C683713C6562DC8
GO
Isoform 4 (identifier: P37275-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-107: RKEGQEILGPEAQADEAGCTV → I

Show »
Length:1,104
Mass (Da):122,003
Checksum:i3F8DAA9A05DFA6E4
GO
Isoform 5 (identifier: P37275-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MADGPRCKRRKQANPRRNN → MK
     87-87: R → TG

Show »
Length:1,108
Mass (Da):122,084
Checksum:i33855F3B478635C8
GO

Sequence cautioni

The sequence BAG62481 differs from that shown. Reason: Frameshift at position 177. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti12 – 121Q → R in BAC03673 (PubMed:14702039).Curated
Sequence conflicti81 – 811N → S in BAC03673 (PubMed:14702039).Curated
Sequence conflicti84 – 841E → K in BAC03673 (PubMed:14702039).Curated
Sequence conflicti220 – 2201T → A in BAG62481 (PubMed:14702039).Curated
Sequence conflicti390 – 3901M → T in BAG62481 (PubMed:14702039).Curated
Sequence conflicti420 – 4201V → I in AAA20602 (Ref. 2) Curated
Sequence conflicti472 – 4721K → R in BAG58962 (PubMed:14702039).Curated
Sequence conflicti609 – 6091E → Q in M81699 (PubMed:1840704).Curated
Sequence conflicti654 – 6541I → T in AAA20602 (Ref. 2) Curated
Sequence conflicti672 – 6721D → H in M81699 (PubMed:1840704).Curated
Sequence conflicti681 – 6811L → S in M81699 (PubMed:1840704).Curated
Sequence conflicti775 – 7751K → T in BAG62481 (PubMed:14702039).Curated
Sequence conflicti793 – 7942IP → KY in BAG58962 (PubMed:14702039).Curated
Sequence conflicti797 – 7971A → N in BAG58962 (PubMed:14702039).Curated
Sequence conflicti818 – 8181A → V in BAG62481 (PubMed:14702039).Curated
Sequence conflicti838 – 8381I → T in BAC03673 (PubMed:14702039).Curated
Sequence conflicti1066 – 10661E → G in BAC03673 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti78 – 781N → T in FECD6; no effect on protein expression; no effect on nuclear localization. 3 Publications
Corresponds to variant rs80194531 [ dbSNP | Ensembl ].
VAR_063759
Natural varianti90 – 901G → R.
Corresponds to variant rs12217419 [ dbSNP | Ensembl ].
VAR_052731
Natural varianti525 – 5251G → E Found in a patient with FECD6. 1 Publication
VAR_072897
Natural varianti553 – 5531K → R.
Corresponds to variant rs35753967 [ dbSNP | Ensembl ].
VAR_031824
Natural varianti640 – 6401Q → H in FECD6; down-regulation of several collagen genes expression. 1 Publication
Corresponds to variant rs779148597 [ dbSNP | Ensembl ].
VAR_072898
Natural varianti649 – 6491P → A in FECD6; no effect on protein expression; no effect on nuclear localization. 2 Publications
Corresponds to variant rs781750314 [ dbSNP | Ensembl ].
VAR_063760
Natural varianti696 – 6961N → S in FECD6; no effect on protein expression; no effect on nuclear localization. 1 Publication
Corresponds to variant rs567252241 [ dbSNP | Ensembl ].
VAR_072899
Natural varianti810 – 8101Q → P in FECD6; no effect on protein expression; no effect on nuclear localization. 2 Publications
Corresponds to variant rs199944415 [ dbSNP | Ensembl ].
VAR_063761
Natural varianti840 – 8401Q → P in FECD6; no effect on protein expression; no effect on nuclear localization. 2 Publications
Corresponds to variant rs118020901 [ dbSNP | Ensembl ].
VAR_063762
Natural varianti905 – 9051A → G in FECD6; no effect on protein expression; no effect on nuclear localization. 1 Publication
Corresponds to variant rs78449005 [ dbSNP | Ensembl ].
VAR_072900
Natural varianti905 – 9051A → T in FECD6. 1 Publication
VAR_063763

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1919MADGP…PRRNN → MK in isoform 5. 1 PublicationVSP_047279Add
BLAST
Alternative sequencei20 – 8768VTNYN…WEDDR → G in isoform 3. 1 PublicationVSP_047280Add
BLAST
Alternative sequencei87 – 10721RKEGQ…AGCTV → I in isoform 4. 1 PublicationVSP_047281Add
BLAST
Alternative sequencei87 – 871R → TG in isoform 2 and isoform 5. 2 PublicationsVSP_045184

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D15050 mRNA. Translation: BAA03646.1.
U12170 mRNA. Translation: AAA20602.1.
AK091478 mRNA. Translation: BAC03673.1.
AK296244 mRNA. Translation: BAG58962.1.
AK300830 mRNA. Translation: BAG62481.1. Frameshift.
AL158080
, AL117340, AL161935, AL355148 Genomic DNA. Translation: CAI17320.1.
AL161935
, AL117340, AL158080, AL355148 Genomic DNA. Translation: CAH74132.1.
AL117340
, AL158080, AL161935, AL355148 Genomic DNA. Translation: CAI12550.1.
AL355148
, AL117340, AL158080, AL161935 Genomic DNA. Translation: CAI15108.1.
CH471072 Genomic DNA. Translation: EAW85989.1.
BC112392 mRNA. Translation: AAI12393.1.
M81699 mRNA. No translation available.
CCDSiCCDS44370.1. [P37275-5]
CCDS53505.1. [P37275-2]
CCDS53506.1. [P37275-4]
CCDS53507.1. [P37275-3]
CCDS7169.1. [P37275-1]
PIRiJX0293.
RefSeqiNP_001121600.1. NM_001128128.2. [P37275-5]
NP_001167564.1. NM_001174093.1. [P37275-4]
NP_001167565.1. NM_001174094.1.
NP_001167566.1. NM_001174095.1. [P37275-3]
NP_001167567.1. NM_001174096.1. [P37275-2]
NP_110378.3. NM_030751.5. [P37275-1]
UniGeneiHs.124503.

Genome annotation databases

EnsembliENST00000320985; ENSP00000319248; ENSG00000148516. [P37275-1]
ENST00000361642; ENSP00000354487; ENSG00000148516. [P37275-2]
ENST00000446923; ENSP00000391612; ENSG00000148516. [P37275-5]
ENST00000542815; ENSP00000444891; ENSG00000148516. [P37275-3]
ENST00000560721; ENSP00000452787; ENSG00000148516. [P37275-4]
GeneIDi6935.
KEGGihsa:6935.
UCSCiuc001ivs.5. human. [P37275-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D15050 mRNA. Translation: BAA03646.1.
U12170 mRNA. Translation: AAA20602.1.
AK091478 mRNA. Translation: BAC03673.1.
AK296244 mRNA. Translation: BAG58962.1.
AK300830 mRNA. Translation: BAG62481.1. Frameshift.
AL158080
, AL117340, AL161935, AL355148 Genomic DNA. Translation: CAI17320.1.
AL161935
, AL117340, AL158080, AL355148 Genomic DNA. Translation: CAH74132.1.
AL117340
, AL158080, AL161935, AL355148 Genomic DNA. Translation: CAI12550.1.
AL355148
, AL117340, AL158080, AL161935 Genomic DNA. Translation: CAI15108.1.
CH471072 Genomic DNA. Translation: EAW85989.1.
BC112392 mRNA. Translation: AAI12393.1.
M81699 mRNA. No translation available.
CCDSiCCDS44370.1. [P37275-5]
CCDS53505.1. [P37275-2]
CCDS53506.1. [P37275-4]
CCDS53507.1. [P37275-3]
CCDS7169.1. [P37275-1]
PIRiJX0293.
RefSeqiNP_001121600.1. NM_001128128.2. [P37275-5]
NP_001167564.1. NM_001174093.1. [P37275-4]
NP_001167565.1. NM_001174094.1.
NP_001167566.1. NM_001174095.1. [P37275-3]
NP_001167567.1. NM_001174096.1. [P37275-2]
NP_110378.3. NM_030751.5. [P37275-1]
UniGeneiHs.124503.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2E19NMR-A586-642[»]
ProteinModelPortaliP37275.
SMRiP37275. Positions 583-642.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112796. 25 interactions.
IntActiP37275. 3 interactions.
MINTiMINT-94525.
STRINGi9606.ENSP00000354487.

PTM databases

iPTMnetiP37275.
PhosphoSiteiP37275.

Polymorphism and mutation databases

BioMutaiZEB1.
DMDMi6166575.

Proteomic databases

EPDiP37275.
MaxQBiP37275.
PaxDbiP37275.
PeptideAtlasiP37275.
PRIDEiP37275.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000320985; ENSP00000319248; ENSG00000148516. [P37275-1]
ENST00000361642; ENSP00000354487; ENSG00000148516. [P37275-2]
ENST00000446923; ENSP00000391612; ENSG00000148516. [P37275-5]
ENST00000542815; ENSP00000444891; ENSG00000148516. [P37275-3]
ENST00000560721; ENSP00000452787; ENSG00000148516. [P37275-4]
GeneIDi6935.
KEGGihsa:6935.
UCSCiuc001ivs.5. human. [P37275-1]

Organism-specific databases

CTDi6935.
GeneCardsiZEB1.
HGNCiHGNC:11642. ZEB1.
HPAiCAB058686.
HPA027524.
MalaCardsiZEB1.
MIMi189909. gene.
609141. phenotype.
613270. phenotype.
neXtProtiNX_P37275.
Orphaneti98974. Fuchs endothelial corneal dystrophy.
98973. Posterior polymorphous corneal dystrophy.
PharmGKBiPA162409589.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3623. Eukaryota.
ENOG410ZFMZ. LUCA.
GeneTreeiENSGT00630000089829.
HOGENOMiHOG000264256.
HOVERGENiHBG004697.
InParanoidiP37275.
KOiK09299.
OMAiECEKPQG.
OrthoDBiEOG091G0F7Y.
PhylomeDBiP37275.
TreeFamiTF331759.

Enzyme and pathway databases

SignaLinkiP37275.
SIGNORiP37275.

Miscellaneous databases

ChiTaRSiZEB1. human.
EvolutionaryTraceiP37275.
GeneWikiiZEB1.
GenomeRNAii6935.
PROiP37275.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000148516.
CleanExiHS_ZEB1.
ExpressionAtlasiP37275. baseline and differential.
GenevisibleiP37275. HS.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
3.30.160.60. 5 hits.
InterProiIPR008598. Di19_Zn_binding_dom.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
PF05605. zf-Di19. 1 hit.
[Graphical view]
SMARTiSM00389. HOX. 1 hit.
SM00355. ZnF_C2H2. 7 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZEB1_HUMAN
AccessioniPrimary (citable) accession number: P37275
Secondary accession number(s): B4DJV0
, B4DUW9, E9PCM7, F5H4I8, Q12924, Q13800, Q2KJ05, Q5T968, Q5VZ84, Q8NB68
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: July 15, 1999
Last modified: September 7, 2016
This is version 173 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.