P37237 (FGF8_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fibroblast growth factor 8 Short name=FGF-8 Alternative name(s): Androgen-induced growth factor Short name=AIGF Heparin-binding growth factor 8 Short name=HBGF-8 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 268 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system By similarity. Cooperates with Wnt-1 in mouse mammary tumor virus-induced murine mammary tumorigenesis. |
| Subunit structure | Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors By similarity. |
| Subcellular location | |
| Tissue specificity | Absent in normal mammary glands and detected only in adult testis and ovary and in midgestational embryos. |
| Induction | By androgens. |
| Post-translational modification | The N-terminus is blocked. |
| Sequence similarities | Belongs to the heparin-binding growth factors family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform FGF-8C (identifier: P37237-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform FGF-8B (identifier: P37237-2) The sequence of this isoform differs from the canonical sequence as follows: 24-87: VRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQR → VTVQSSPNFTQ | ||||||
| Isoform FGF-8A (identifier: P37237-3) The sequence of this isoform differs from the canonical sequence as follows: 24-87: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Potential | ||||||
| Chain | 23 – 268 | 246 | Fibroblast growth factor 8 | PRO_0000008971 | |||||
Amino acid modifications | |||||||||
| Modified residue | 23 | 1 | Pyrrolidone carboxylic acid Potential | ||||||
| Glycosylation | 60 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 190 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 24 – 87 | 64 | Missing in isoform FGF-8A. | VSP_001528 | |||||
| Alternative sequence | 24 – 87 | 64 | VRSAA…KVTQR → VTVQSSPNFTQ in isoform FGF-8B. | VSP_001527 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Cloning and characterization of an androgen-induced growth factor essential for the androgen-dependent growth of mouse mammary carcinoma cells." Tanaka A., Miyamoto K., Minamino N., Takeda M., Sato B., Matsuo H., Matsumoto K. Proc. Natl. Acad. Sci. U.S.A. 89:8928-8932(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE. |
| [2] | "Fgf-8, activated by proviral insertion, cooperates with the Wnt-1 transgene in murine mammary tumorigenesis." Macarthur C.A., Shankar D.B., Shackleford G.M. J. Virol. 69:2501-2507(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Mammary carcinoma. |
| [3] | "A role for FGF-8 in the initiation and maintenance of vertebrate limb bud outgrowth." Mahmood R., Bresnick J., Hornbruch A., Mahony C., Morton N., Colquhoun K., Martin P., Lumsden A., Dickson C., Mason I. Curr. Biol. 5:797-806(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D12483 mRNA. Translation: BAA02051.1. D12482 mRNA. Translation: BAA02050.1. U18673 mRNA. Translation: AAA65387.1. Z48746 mRNA. Translation: CAA88637.1. |
| IPI | IPI00125192. IPI00230745. IPI00230746. |
| PIR | A46245. B46245. |
| RefSeq | NP_001159834.1. NM_001166362.1. NP_001159835.1. NM_001166363.1. NP_034335.1. NM_010205.2. |
| UniGene | Mm.4012. |
3D structure databases | |
| ProteinModelPortal | P37237. |
| SMR | P37237. Positions 87-233. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-6030N. |
| STRING | 10090.ENSMUSP00000026241. |
PTM databases | |
| PhosphoSite | P37237. |
Proteomic databases | |
| PRIDE | P37237. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000026241; ENSMUSP00000026241; ENSMUSG00000025219. ENSMUST00000111927; ENSMUSP00000107558; ENSMUSG00000025219. ENSMUST00000111928; ENSMUSP00000107559; ENSMUSG00000025219. |
| GeneID | 14179. |
| KEGG | mmu:14179. |
| UCSC | uc008hrh.2. mouse. uc012bmo.1. mouse. |
Organism-specific databases | |
| CTD | 2253. |
| MGI | MGI:99604. Fgf8. |
Phylogenomic databases | |
| eggNOG | NOG327940. |
| GeneTree | ENSGT00690000101834. |
| HOGENOM | HOG000115986. |
| HOVERGEN | HBG005659. |
| InParanoid | P37237. |
| KO | K04358. |
Gene expression databases | |
| ArrayExpress | P37237. |
| Bgee | P37237. |
| CleanEx | MM_FGF8. |
| Genevestigator | P37237. |
| GermOnline | ENSMUSG00000025219. Mus musculus. |
Family and domain databases | |
| InterPro | IPR008996. Cytokine_IL1-like. IPR002348. IL1_HBGF. [Graphical view] |
| PANTHER | PTHR11486. PTHR11486. 1 hit. |
| Pfam | PF00167. FGF. 1 hit. [Graphical view] |
| PRINTS | PR00262. IL1HBGF. |
| SMART | SM00442. FGF. 1 hit. [Graphical view] |
| SUPFAM | SSF50353. Cytok_IL1_like. 1 hit. |
| PROSITE | PS00247. HBGF_FGF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 285366. |
| SOURCE | Search... |
Entry information
| Entry name | FGF8_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P37237 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
