Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fibroblast growth factor 8

Gene

Fgf8

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Plays a role in neurite outgrowth in hippocampal cells (By similarity). Cooperates with Wnt-1 in mouse mammary tumor virus-induced murine mammary tumorigenesis (PubMed:7884899).By similarity

GO - Molecular functioni

GO - Biological processi

  • aorta morphogenesis Source: MGI
  • apoptotic process Source: MGI
  • blood vessel remodeling Source: MGI
  • BMP signaling pathway Source: MGI
  • bone development Source: MGI
  • branching involved in salivary gland morphogenesis Source: MGI
  • branching involved in ureteric bud morphogenesis Source: MGI
  • canonical Wnt signaling pathway Source: MGI
  • cell fate commitment Source: MGI
  • cell migration involved in mesendoderm migration Source: MGI
  • cell proliferation in forebrain Source: MGI
  • corticotropin hormone secreting cell differentiation Source: MGI
  • determination of left/right symmetry Source: MGI
  • dopaminergic neuron differentiation Source: MGI
  • dorsal/ventral axon guidance Source: Ensembl
  • embryo development ending in birth or egg hatching Source: MGI
  • embryonic heart tube development Source: MGI
  • embryonic hindlimb morphogenesis Source: MGI
  • epithelial to mesenchymal transition involved in endocardial cushion formation Source: BHF-UCL
  • fibroblast growth factor receptor signaling pathway Source: MGI
  • forebrain dorsal/ventral pattern formation Source: MGI
  • forebrain morphogenesis Source: MGI
  • forebrain neuron development Source: Ensembl
  • generation of neurons Source: MGI
  • gonad development Source: MGI
  • heart development Source: MGI
  • heart looping Source: MGI
  • heart morphogenesis Source: MGI
  • inner ear morphogenesis Source: MGI
  • kidney development Source: MGI
  • limb morphogenesis Source: MGI
  • lung development Source: MGI
  • lung morphogenesis Source: MGI
  • male genitalia development Source: MGI
  • MAPK cascade Source: MGI
  • mesodermal cell migration Source: MGI
  • metanephros development Source: Ensembl
  • midbrain-hindbrain boundary development Source: MGI
  • motor neuron axon guidance Source: Ensembl
  • negative regulation of apoptotic process Source: MGI
  • negative regulation of cardiac muscle tissue development Source: MGI
  • negative regulation of neuron apoptotic process Source: MGI
  • neural plate morphogenesis Source: MGI
  • neuroepithelial cell differentiation Source: MGI
  • odontogenesis Source: Ensembl
  • organ induction Source: MGI
  • otic vesicle formation Source: MGI
  • outflow tract morphogenesis Source: MGI
  • outflow tract septum morphogenesis Source: UniProtKB
  • pallium development Source: MGI
  • patterning of blood vessels Source: MGI
  • pharyngeal system development Source: MGI
  • positive regulation of cell proliferation Source: MGI
  • positive regulation of gene expression Source: MGI
  • positive regulation of mitotic nuclear division Source: MGI
  • positive regulation of organ growth Source: MGI
  • regulation of odontogenesis of dentin-containing tooth Source: MGI
  • response to drug Source: Ensembl
  • response to organic cyclic compound Source: Ensembl
  • response to oxidative stress Source: Ensembl
  • signal transduction involved in regulation of gene expression Source: MGI
  • subpallium development Source: MGI
  • telencephalon development Source: MGI
  • thyroid gland development Source: MGI
  • thyroid-stimulating hormone-secreting cell differentiation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Growth factor, Mitogen

Keywords - Biological processi

Differentiation

Enzyme and pathway databases

ReactomeiREACT_276236. FGFR4 ligand binding and activation.
REACT_312401. FGFR2c ligand binding and activation.
REACT_317910. FGFR3b ligand binding and activation.
REACT_332866. PI3K Cascade.
REACT_333335. FGFR3c ligand binding and activation.
REACT_333474. PIP3 activates AKT signaling.
REACT_354830. FGFR1c ligand binding and activation.
REACT_357393. Negative regulation of FGFR2 signaling.
REACT_357671. FRS-mediated FGFR1 signaling.
REACT_357826. Negative regulation of FGFR3 signaling.
REACT_358096. Phospholipase C-mediated cascade: FGFR1.
REACT_358477. Negative regulation of FGFR4 signaling.
REACT_358810. FRS-mediated FGFR3 signaling.
REACT_358906. SHC-mediated cascade:FGFR4.
REACT_359069. Phospholipase C-mediated cascade, FGFR2.
REACT_359386. Phospholipase C-mediated cascade, FGFR3.
REACT_359435. Negative regulation of FGFR1 signaling.
REACT_359700. FRS-mediated FGFR2 signaling.
REACT_359709. PI-3K cascade:FGFR2.
REACT_360720. Phospholipase C-mediated cascade, FGFR4.
REACT_360961. PI-3K cascade:FGFR3.
REACT_361038. PI-3K cascade:FGFR4.
REACT_361588. SHC-mediated cascade:FGFR2.
REACT_361629. PI-3K cascade:FGFR1.
REACT_361658. FRS2-mediated FGFR4 signaling.
REACT_361860. SHC-mediated cascade:FGFR1.
REACT_361987. SHC-mediated cascade:FGFR3.

Names & Taxonomyi

Protein namesi
Recommended name:
Fibroblast growth factor 8
Short name:
FGF-8
Alternative name(s):
Androgen-induced growth factor
Short name:
AIGF
Heparin-binding growth factor 8
Short name:
HBGF-8
Gene namesi
Name:Fgf8
Synonyms:Aigf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 19

Organism-specific databases

MGIiMGI:99604. Fgf8.

Subcellular locationi

GO - Cellular componenti

  • external side of plasma membrane Source: Ensembl
  • extracellular space Source: MGI
  • intracellular Source: GOC
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222Sequence AnalysisAdd
BLAST
Chaini23 – 268246Fibroblast growth factor 8PRO_0000008971Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei23 – 231Pyrrolidone carboxylic acidSequence Analysis
Glycosylationi60 – 601N-linked (GlcNAc...)Sequence Analysis
Glycosylationi190 – 1901N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

The N-terminus is blocked.

Keywords - PTMi

Glycoprotein, Pyrrolidone carboxylic acid

Proteomic databases

PRIDEiP37237.

PTM databases

PhosphoSiteiP37237.

Expressioni

Tissue specificityi

Absent in normal mammary glands and detected only in adult testis and ovary and in midgestational embryos.

Inductioni

By androgens.

Gene expression databases

BgeeiP37237.
CleanExiMM_FGF8.
ExpressionAtlasiP37237. baseline and differential.
GenevisibleiP37237. MM.

Interactioni

Subunit structurei

Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors (By similarity).By similarity

Protein-protein interaction databases

DIPiDIP-6030N.
IntActiP37237. 1 interaction.
STRINGi10090.ENSMUSP00000026241.

Structurei

3D structure databases

ProteinModelPortaliP37237.
SMRiP37237. Positions 87-233.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG327940.
GeneTreeiENSGT00730000110785.
HOGENOMiHOG000115986.
HOVERGENiHBG005659.
InParanoidiP37237.
KOiK04358.
PhylomeDBiP37237.
TreeFamiTF331233.

Family and domain databases

InterProiIPR008996. Cytokine_IL1-like.
IPR028249. FGF8.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERiPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF3. PTHR11486:SF3. 1 hit.
PRINTSiPR00262. IL1HBGF.
SMARTiSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMiSSF50353. SSF50353. 1 hit.
PROSITEiPS00247. HBGF_FGF. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.

Isoform FGF-8C (identifier: P37237-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSPRSALSC LLLHLLVLCL QAQVRSAAQK RGPGAGNPAD TLGQGHEDRP
60 70 80 90 100
FGQRSRAGKN FTNPAPNYPE EGSKEQRDSV LPKVTQRHVR EQSLVTDQLS
110 120 130 140 150
RRLIRTYQLY SRTSGKHVQV LANKRINAMA EDGDPFAKLI VETDTFGSRV
160 170 180 190 200
RVRGAETGLY ICMNKKGKLI AKSNGKGKDC VFTEIVLENN YTALQNAKYE
210 220 230 240 250
GWYMAFTRKG RPRKGSKTRQ HQREVHFMKR LPRGHHTTEQ SLRFEFLNYP
260
PFTRSLRGSQ RTWAPEPR
Length:268
Mass (Da):30,420
Last modified:October 1, 1994 - v1
Checksum:i3330A9F342AD7109
GO
Isoform FGF-8B (identifier: P37237-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-87: VRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQR → VTVQSSPNFTQ

Show »
Length:215
Mass (Da):24,711
Checksum:iA39424271EF7CBFF
GO
Isoform FGF-8A (identifier: P37237-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-87: Missing.

Show »
Length:204
Mass (Da):23,522
Checksum:i9A4CAB7686A2B190
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei24 – 8764Missing in isoform FGF-8A. CuratedVSP_001528Add
BLAST
Alternative sequencei24 – 8764VRSAA…KVTQR → VTVQSSPNFTQ in isoform FGF-8B. CuratedVSP_001527Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D12483 mRNA. Translation: BAA02051.1.
D12482 mRNA. Translation: BAA02050.1.
U18673 mRNA. Translation: AAA65387.1.
Z48746 mRNA. Translation: CAA88637.1.
CCDSiCCDS29864.1. [P37237-1]
CCDS50450.1. [P37237-3]
CCDS50451.1. [P37237-2]
PIRiA46245.
B46245.
RefSeqiNP_001159834.1. NM_001166362.1. [P37237-2]
NP_001159835.1. NM_001166363.1. [P37237-3]
NP_034335.1. NM_010205.2. [P37237-1]
UniGeneiMm.4012.

Genome annotation databases

EnsembliENSMUST00000026241; ENSMUSP00000026241; ENSMUSG00000025219. [P37237-1]
ENSMUST00000111927; ENSMUSP00000107558; ENSMUSG00000025219. [P37237-3]
ENSMUST00000111928; ENSMUSP00000107559; ENSMUSG00000025219. [P37237-2]
GeneIDi14179.
KEGGimmu:14179.
UCSCiuc008hrh.2. mouse. [P37237-3]
uc012bmo.1. mouse. [P37237-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D12483 mRNA. Translation: BAA02051.1.
D12482 mRNA. Translation: BAA02050.1.
U18673 mRNA. Translation: AAA65387.1.
Z48746 mRNA. Translation: CAA88637.1.
CCDSiCCDS29864.1. [P37237-1]
CCDS50450.1. [P37237-3]
CCDS50451.1. [P37237-2]
PIRiA46245.
B46245.
RefSeqiNP_001159834.1. NM_001166362.1. [P37237-2]
NP_001159835.1. NM_001166363.1. [P37237-3]
NP_034335.1. NM_010205.2. [P37237-1]
UniGeneiMm.4012.

3D structure databases

ProteinModelPortaliP37237.
SMRiP37237. Positions 87-233.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-6030N.
IntActiP37237. 1 interaction.
STRINGi10090.ENSMUSP00000026241.

PTM databases

PhosphoSiteiP37237.

Proteomic databases

PRIDEiP37237.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000026241; ENSMUSP00000026241; ENSMUSG00000025219. [P37237-1]
ENSMUST00000111927; ENSMUSP00000107558; ENSMUSG00000025219. [P37237-3]
ENSMUST00000111928; ENSMUSP00000107559; ENSMUSG00000025219. [P37237-2]
GeneIDi14179.
KEGGimmu:14179.
UCSCiuc008hrh.2. mouse. [P37237-3]
uc012bmo.1. mouse. [P37237-1]

Organism-specific databases

CTDi2253.
MGIiMGI:99604. Fgf8.

Phylogenomic databases

eggNOGiNOG327940.
GeneTreeiENSGT00730000110785.
HOGENOMiHOG000115986.
HOVERGENiHBG005659.
InParanoidiP37237.
KOiK04358.
PhylomeDBiP37237.
TreeFamiTF331233.

Enzyme and pathway databases

ReactomeiREACT_276236. FGFR4 ligand binding and activation.
REACT_312401. FGFR2c ligand binding and activation.
REACT_317910. FGFR3b ligand binding and activation.
REACT_332866. PI3K Cascade.
REACT_333335. FGFR3c ligand binding and activation.
REACT_333474. PIP3 activates AKT signaling.
REACT_354830. FGFR1c ligand binding and activation.
REACT_357393. Negative regulation of FGFR2 signaling.
REACT_357671. FRS-mediated FGFR1 signaling.
REACT_357826. Negative regulation of FGFR3 signaling.
REACT_358096. Phospholipase C-mediated cascade: FGFR1.
REACT_358477. Negative regulation of FGFR4 signaling.
REACT_358810. FRS-mediated FGFR3 signaling.
REACT_358906. SHC-mediated cascade:FGFR4.
REACT_359069. Phospholipase C-mediated cascade, FGFR2.
REACT_359386. Phospholipase C-mediated cascade, FGFR3.
REACT_359435. Negative regulation of FGFR1 signaling.
REACT_359700. FRS-mediated FGFR2 signaling.
REACT_359709. PI-3K cascade:FGFR2.
REACT_360720. Phospholipase C-mediated cascade, FGFR4.
REACT_360961. PI-3K cascade:FGFR3.
REACT_361038. PI-3K cascade:FGFR4.
REACT_361588. SHC-mediated cascade:FGFR2.
REACT_361629. PI-3K cascade:FGFR1.
REACT_361658. FRS2-mediated FGFR4 signaling.
REACT_361860. SHC-mediated cascade:FGFR1.
REACT_361987. SHC-mediated cascade:FGFR3.

Miscellaneous databases

NextBioi285366.
PROiP37237.
SOURCEiSearch...

Gene expression databases

BgeeiP37237.
CleanExiMM_FGF8.
ExpressionAtlasiP37237. baseline and differential.
GenevisibleiP37237. MM.

Family and domain databases

InterProiIPR008996. Cytokine_IL1-like.
IPR028249. FGF8.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERiPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF3. PTHR11486:SF3. 1 hit.
PRINTSiPR00262. IL1HBGF.
SMARTiSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMiSSF50353. SSF50353. 1 hit.
PROSITEiPS00247. HBGF_FGF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Cloning and characterization of an androgen-induced growth factor essential for the androgen-dependent growth of mouse mammary carcinoma cells."
    Tanaka A., Miyamoto K., Minamino N., Takeda M., Sato B., Matsuo H., Matsumoto K.
    Proc. Natl. Acad. Sci. U.S.A. 89:8928-8932(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE.
  2. "Fgf-8, activated by proviral insertion, cooperates with the Wnt-1 transgene in murine mammary tumorigenesis."
    Macarthur C.A., Shankar D.B., Shackleford G.M.
    J. Virol. 69:2501-2507(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], FUNCTION.
    Tissue: Mammary carcinoma.
  3. "A role for FGF-8 in the initiation and maintenance of vertebrate limb bud outgrowth."
    Mahmood R., Bresnick J., Hornbruch A., Mahony C., Morton N., Colquhoun K., Martin P., Lumsden A., Dickson C., Mason I.
    Curr. Biol. 5:797-806(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].

Entry informationi

Entry nameiFGF8_MOUSE
AccessioniPrimary (citable) accession number: P37237
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: October 1, 1994
Last modified: June 24, 2015
This is version 138 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.