Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P37237

- FGF8_MOUSE

UniProt

P37237 - FGF8_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Fibroblast growth factor 8

Gene

Fgf8

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system By similarity. Cooperates with Wnt-1 in mouse mammary tumor virus-induced murine mammary tumorigenesis.By similarity

GO - Molecular functioni

  1. chemoattractant activity Source: Ensembl

GO - Biological processi

  1. aorta morphogenesis Source: MGI
  2. apoptotic process Source: MGI
  3. blood vessel remodeling Source: MGI
  4. BMP signaling pathway Source: MGI
  5. bone development Source: Ensembl
  6. branching involved in salivary gland morphogenesis Source: MGI
  7. branching involved in ureteric bud morphogenesis Source: MGI
  8. canonical Wnt signaling pathway Source: MGI
  9. cell fate commitment Source: MGI
  10. cell migration involved in mesendoderm migration Source: MGI
  11. cell proliferation in forebrain Source: MGI
  12. corticotropin hormone secreting cell differentiation Source: MGI
  13. determination of left/right symmetry Source: MGI
  14. dopaminergic neuron differentiation Source: Ensembl
  15. dorsal/ventral axon guidance Source: Ensembl
  16. embryo development ending in birth or egg hatching Source: MGI
  17. embryonic heart tube development Source: MGI
  18. embryonic hindlimb morphogenesis Source: MGI
  19. epithelial to mesenchymal transition involved in endocardial cushion formation Source: BHF-UCL
  20. fibroblast growth factor receptor signaling pathway Source: MGI
  21. forebrain dorsal/ventral pattern formation Source: MGI
  22. forebrain morphogenesis Source: MGI
  23. forebrain neuron development Source: Ensembl
  24. generation of neurons Source: MGI
  25. gonad development Source: Ensembl
  26. heart development Source: MGI
  27. heart looping Source: MGI
  28. heart morphogenesis Source: MGI
  29. inner ear morphogenesis Source: MGI
  30. kidney development Source: MGI
  31. limb morphogenesis Source: MGI
  32. lung development Source: MGI
  33. lung morphogenesis Source: MGI
  34. male genitalia development Source: MGI
  35. MAPK cascade Source: MGI
  36. mesodermal cell migration Source: MGI
  37. metanephros development Source: Ensembl
  38. midbrain-hindbrain boundary development Source: MGI
  39. motor neuron axon guidance Source: Ensembl
  40. negative regulation of apoptotic process Source: MGI
  41. negative regulation of cardiac muscle tissue development Source: Ensembl
  42. negative regulation of neuron apoptotic process Source: MGI
  43. neural plate morphogenesis Source: MGI
  44. odontogenesis Source: Ensembl
  45. organ induction Source: MGI
  46. otic vesicle formation Source: MGI
  47. outflow tract morphogenesis Source: MGI
  48. outflow tract septum morphogenesis Source: UniProtKB
  49. pallium development Source: MGI
  50. patterning of blood vessels Source: MGI
  51. pharyngeal system development Source: MGI
  52. positive regulation of cell division Source: UniProtKB-KW
  53. positive regulation of cell proliferation Source: MGI
  54. positive regulation of gene expression Source: MGI
  55. positive regulation of mitosis Source: MGI
  56. positive regulation of organ growth Source: MGI
  57. regulation of odontogenesis of dentin-containing tooth Source: MGI
  58. response to drug Source: Ensembl
  59. response to organic cyclic compound Source: Ensembl
  60. response to oxidative stress Source: Ensembl
  61. signal transduction involved in regulation of gene expression Source: MGI
  62. subpallium development Source: MGI
  63. telencephalon development Source: MGI
  64. thyroid gland development Source: MGI
  65. thyroid-stimulating hormone-secreting cell differentiation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Growth factor, Mitogen

Keywords - Biological processi

Differentiation

Enzyme and pathway databases

ReactomeiREACT_196455. Signaling by FGFR mutants.
REACT_196505. Signaling by FGFR3 mutants.
REACT_196507. Signaling by activated point mutants of FGFR3.
REACT_196536. Activated point mutants of FGFR2.
REACT_196538. Signaling by activated point mutants of FGFR1.
REACT_196588. Constitutive PI3K/AKT Signaling in Cancer.
REACT_198525. Negative regulation of FGFR signaling.
REACT_206694. FGFR4 ligand binding and activation.
REACT_206745. FGFR2c ligand binding and activation.
REACT_213224. FGFR3b ligand binding and activation.
REACT_220750. FGFR3c ligand binding and activation.
REACT_223993. PI-3K cascade.
REACT_225874. FGFR1c ligand binding and activation.
REACT_226341. PIP3 activates AKT signaling.
REACT_94437. SHC-mediated cascade.

Names & Taxonomyi

Protein namesi
Recommended name:
Fibroblast growth factor 8
Short name:
FGF-8
Alternative name(s):
Androgen-induced growth factor
Short name:
AIGF
Heparin-binding growth factor 8
Short name:
HBGF-8
Gene namesi
Name:Fgf8
Synonyms:Aigf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 19

Organism-specific databases

MGIiMGI:99604. Fgf8.

Subcellular locationi

GO - Cellular componenti

  1. external side of plasma membrane Source: Ensembl
  2. extracellular space Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222Sequence AnalysisAdd
BLAST
Chaini23 – 268246Fibroblast growth factor 8PRO_0000008971Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei23 – 231Pyrrolidone carboxylic acidSequence Analysis
Glycosylationi60 – 601N-linked (GlcNAc...)Sequence Analysis
Glycosylationi190 – 1901N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

The N-terminus is blocked.

Keywords - PTMi

Glycoprotein, Pyrrolidone carboxylic acid

Proteomic databases

PRIDEiP37237.

PTM databases

PhosphoSiteiP37237.

Expressioni

Tissue specificityi

Absent in normal mammary glands and detected only in adult testis and ovary and in midgestational embryos.

Inductioni

By androgens.

Gene expression databases

BgeeiP37237.
CleanExiMM_FGF8.
ExpressionAtlasiP37237. baseline and differential.
GenevestigatoriP37237.

Interactioni

Subunit structurei

Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors By similarity.By similarity

Protein-protein interaction databases

DIPiDIP-6030N.
IntActiP37237. 1 interaction.
STRINGi10090.ENSMUSP00000026241.

Structurei

3D structure databases

ProteinModelPortaliP37237.
SMRiP37237. Positions 87-233.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG327940.
GeneTreeiENSGT00730000110785.
HOGENOMiHOG000115986.
HOVERGENiHBG005659.
InParanoidiP37237.
KOiK04358.
OMAiGHEDRPF.
PhylomeDBiP37237.
TreeFamiTF331233.

Family and domain databases

InterProiIPR008996. Cytokine_IL1-like.
IPR028249. FGF8.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERiPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF3. PTHR11486:SF3. 1 hit.
PRINTSiPR00262. IL1HBGF.
SMARTiSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMiSSF50353. SSF50353. 1 hit.
PROSITEiPS00247. HBGF_FGF. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform FGF-8C (identifier: P37237-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSPRSALSC LLLHLLVLCL QAQVRSAAQK RGPGAGNPAD TLGQGHEDRP
60 70 80 90 100
FGQRSRAGKN FTNPAPNYPE EGSKEQRDSV LPKVTQRHVR EQSLVTDQLS
110 120 130 140 150
RRLIRTYQLY SRTSGKHVQV LANKRINAMA EDGDPFAKLI VETDTFGSRV
160 170 180 190 200
RVRGAETGLY ICMNKKGKLI AKSNGKGKDC VFTEIVLENN YTALQNAKYE
210 220 230 240 250
GWYMAFTRKG RPRKGSKTRQ HQREVHFMKR LPRGHHTTEQ SLRFEFLNYP
260
PFTRSLRGSQ RTWAPEPR
Length:268
Mass (Da):30,420
Last modified:October 1, 1994 - v1
Checksum:i3330A9F342AD7109
GO
Isoform FGF-8B (identifier: P37237-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-87: VRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQR → VTVQSSPNFTQ

Show »
Length:215
Mass (Da):24,711
Checksum:iA39424271EF7CBFF
GO
Isoform FGF-8A (identifier: P37237-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-87: Missing.

Show »
Length:204
Mass (Da):23,522
Checksum:i9A4CAB7686A2B190
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei24 – 8764Missing in isoform FGF-8A. CuratedVSP_001528Add
BLAST
Alternative sequencei24 – 8764VRSAA…KVTQR → VTVQSSPNFTQ in isoform FGF-8B. CuratedVSP_001527Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D12483 mRNA. Translation: BAA02051.1.
D12482 mRNA. Translation: BAA02050.1.
U18673 mRNA. Translation: AAA65387.1.
Z48746 mRNA. Translation: CAA88637.1.
CCDSiCCDS29864.1. [P37237-1]
CCDS50450.1. [P37237-3]
CCDS50451.1. [P37237-2]
PIRiA46245.
B46245.
RefSeqiNP_001159834.1. NM_001166362.1. [P37237-2]
NP_001159835.1. NM_001166363.1. [P37237-3]
NP_034335.1. NM_010205.2. [P37237-1]
UniGeneiMm.4012.

Genome annotation databases

EnsembliENSMUST00000026241; ENSMUSP00000026241; ENSMUSG00000025219. [P37237-1]
ENSMUST00000111927; ENSMUSP00000107558; ENSMUSG00000025219. [P37237-3]
ENSMUST00000111928; ENSMUSP00000107559; ENSMUSG00000025219. [P37237-2]
GeneIDi14179.
KEGGimmu:14179.
UCSCiuc008hrh.2. mouse. [P37237-3]
uc012bmo.1. mouse. [P37237-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D12483 mRNA. Translation: BAA02051.1 .
D12482 mRNA. Translation: BAA02050.1 .
U18673 mRNA. Translation: AAA65387.1 .
Z48746 mRNA. Translation: CAA88637.1 .
CCDSi CCDS29864.1. [P37237-1 ]
CCDS50450.1. [P37237-3 ]
CCDS50451.1. [P37237-2 ]
PIRi A46245.
B46245.
RefSeqi NP_001159834.1. NM_001166362.1. [P37237-2 ]
NP_001159835.1. NM_001166363.1. [P37237-3 ]
NP_034335.1. NM_010205.2. [P37237-1 ]
UniGenei Mm.4012.

3D structure databases

ProteinModelPortali P37237.
SMRi P37237. Positions 87-233.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

DIPi DIP-6030N.
IntActi P37237. 1 interaction.
STRINGi 10090.ENSMUSP00000026241.

PTM databases

PhosphoSitei P37237.

Proteomic databases

PRIDEi P37237.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000026241 ; ENSMUSP00000026241 ; ENSMUSG00000025219 . [P37237-1 ]
ENSMUST00000111927 ; ENSMUSP00000107558 ; ENSMUSG00000025219 . [P37237-3 ]
ENSMUST00000111928 ; ENSMUSP00000107559 ; ENSMUSG00000025219 . [P37237-2 ]
GeneIDi 14179.
KEGGi mmu:14179.
UCSCi uc008hrh.2. mouse. [P37237-3 ]
uc012bmo.1. mouse. [P37237-1 ]

Organism-specific databases

CTDi 2253.
MGIi MGI:99604. Fgf8.

Phylogenomic databases

eggNOGi NOG327940.
GeneTreei ENSGT00730000110785.
HOGENOMi HOG000115986.
HOVERGENi HBG005659.
InParanoidi P37237.
KOi K04358.
OMAi GHEDRPF.
PhylomeDBi P37237.
TreeFami TF331233.

Enzyme and pathway databases

Reactomei REACT_196455. Signaling by FGFR mutants.
REACT_196505. Signaling by FGFR3 mutants.
REACT_196507. Signaling by activated point mutants of FGFR3.
REACT_196536. Activated point mutants of FGFR2.
REACT_196538. Signaling by activated point mutants of FGFR1.
REACT_196588. Constitutive PI3K/AKT Signaling in Cancer.
REACT_198525. Negative regulation of FGFR signaling.
REACT_206694. FGFR4 ligand binding and activation.
REACT_206745. FGFR2c ligand binding and activation.
REACT_213224. FGFR3b ligand binding and activation.
REACT_220750. FGFR3c ligand binding and activation.
REACT_223993. PI-3K cascade.
REACT_225874. FGFR1c ligand binding and activation.
REACT_226341. PIP3 activates AKT signaling.
REACT_94437. SHC-mediated cascade.

Miscellaneous databases

NextBioi 285366.
PROi P37237.
SOURCEi Search...

Gene expression databases

Bgeei P37237.
CleanExi MM_FGF8.
ExpressionAtlasi P37237. baseline and differential.
Genevestigatori P37237.

Family and domain databases

InterProi IPR008996. Cytokine_IL1-like.
IPR028249. FGF8.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view ]
PANTHERi PTHR11486. PTHR11486. 1 hit.
PTHR11486:SF3. PTHR11486:SF3. 1 hit.
PRINTSi PR00262. IL1HBGF.
SMARTi SM00442. FGF. 1 hit.
[Graphical view ]
SUPFAMi SSF50353. SSF50353. 1 hit.
PROSITEi PS00247. HBGF_FGF. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Cloning and characterization of an androgen-induced growth factor essential for the androgen-dependent growth of mouse mammary carcinoma cells."
    Tanaka A., Miyamoto K., Minamino N., Takeda M., Sato B., Matsuo H., Matsumoto K.
    Proc. Natl. Acad. Sci. U.S.A. 89:8928-8932(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE.
  2. "Fgf-8, activated by proviral insertion, cooperates with the Wnt-1 transgene in murine mammary tumorigenesis."
    Macarthur C.A., Shankar D.B., Shackleford G.M.
    J. Virol. 69:2501-2507(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Tissue: Mammary carcinoma.
  3. "A role for FGF-8 in the initiation and maintenance of vertebrate limb bud outgrowth."
    Mahmood R., Bresnick J., Hornbruch A., Mahony C., Morton N., Colquhoun K., Martin P., Lumsden A., Dickson C., Mason I.
    Curr. Biol. 5:797-806(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].

Entry informationi

Entry nameiFGF8_MOUSE
AccessioniPrimary (citable) accession number: P37237
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: October 1, 1994
Last modified: October 29, 2014
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3