Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P37237 (FGF8_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 125. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Fibroblast growth factor 8

Short name=FGF-8
Alternative name(s):
Androgen-induced growth factor
Short name=AIGF
Heparin-binding growth factor 8
Short name=HBGF-8
Gene names
Name:Fgf8
Synonyms:Aigf
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length268 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system By similarity. Cooperates with Wnt-1 in mouse mammary tumor virus-induced murine mammary tumorigenesis.

Subunit structure

Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors By similarity.

Subcellular location

Secreted.

Tissue specificity

Absent in normal mammary glands and detected only in adult testis and ovary and in midgestational embryos.

Induction

By androgens.

Post-translational modification

The N-terminus is blocked.

Sequence similarities

Belongs to the heparin-binding growth factors family.

Ontologies

Keywords
   Biological processDifferentiation
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
   DomainSignal
   Molecular functionDevelopmental protein
Growth factor
Mitogen
   PTMGlycoprotein
Pyrrolidone carboxylic acid
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processBMP signaling pathway

Inferred from direct assay PubMed 17360443. Source: MGI

MAPK cascade

Inferred from mutant phenotype PubMed 16720880. Source: MGI

aorta morphogenesis

Inferred from genetic interaction PubMed 21364285. Source: MGI

apoptotic process

Inferred from mutant phenotype PubMed 16613831. Source: MGI

blood vessel remodeling

Inferred from genetic interaction PubMed 17000704. Source: MGI

bone development

Inferred from electronic annotation. Source: Ensembl

branching involved in salivary gland morphogenesis

Inferred from mutant phenotype PubMed 15063181. Source: MGI

branching involved in ureteric bud morphogenesis

Inferred from mutant phenotype PubMed 16049111. Source: MGI

canonical Wnt signaling pathway

Inferred from direct assay PubMed 17360443. Source: MGI

cell fate commitment

Inferred from genetic interaction PubMed 15809037. Source: MGI

cell migration involved in mesendoderm migration

Inferred from mutant phenotype PubMed 10421635. Source: MGI

cell proliferation in forebrain

Inferred from mutant phenotype PubMed 16613831. Source: MGI

corticotropin hormone secreting cell differentiation

Inferred from direct assay PubMed 9463347. Source: MGI

determination of left/right symmetry

Inferred from mutant phenotype PubMed 10411502. Source: MGI

dopaminergic neuron differentiation

Inferred from electronic annotation. Source: Ensembl

dorsal/ventral axon guidance

Inferred from electronic annotation. Source: Ensembl

embryo development ending in birth or egg hatching

Inferred from mutant phenotype PubMed 14623825. Source: MGI

embryonic heart tube development

Inferred from mutant phenotype PubMed 16720879. Source: MGI

embryonic hindlimb morphogenesis

Inferred from genetic interaction PubMed 16245339. Source: MGI

epithelial to mesenchymal transition involved in endocardial cushion formation

Inferred from mutant phenotype PubMed 19509466. Source: BHF-UCL

fibroblast growth factor receptor signaling pathway

Inferred from direct assay PubMed 10381577PubMed 9435295. Source: MGI

forebrain dorsal/ventral pattern formation

Inferred from mutant phenotype PubMed 16613831. Source: MGI

forebrain morphogenesis

Inferred from mutant phenotype PubMed 16613831. Source: MGI

forebrain neuron development

Inferred from electronic annotation. Source: Ensembl

generation of neurons

Inferred from mutant phenotype PubMed 16267092. Source: MGI

gonad development

Inferred from electronic annotation. Source: Ensembl

heart development

Inferred from mutant phenotype PubMed 16720879PubMed 16720880. Source: MGI

heart looping

Inferred from mutant phenotype PubMed 10411502. Source: MGI

heart morphogenesis

Inferred from mutant phenotype PubMed 16696966. Source: MGI

inner ear morphogenesis

Inferred from genetic interaction PubMed 15809037. Source: MGI

kidney development

Inferred from mutant phenotype PubMed 16049111. Source: MGI

limb morphogenesis

Inferred from genetic interaction PubMed 15328019. Source: MGI

lung development

Inferred from mutant phenotype PubMed 10411502. Source: MGI

lung morphogenesis

Inferred from mutant phenotype PubMed 10411502. Source: MGI

male genitalia development

Inferred from direct assay PubMed 12783783. Source: MGI

mesodermal cell migration

Inferred from mutant phenotype PubMed 10421635. Source: MGI

mesonephros development

Inferred from electronic annotation. Source: Ensembl

metanephros development

Inferred from electronic annotation. Source: Ensembl

midbrain-hindbrain boundary development

Inferred from mutant phenotype PubMed 17601531. Source: MGI

motor neuron axon guidance

Inferred from electronic annotation. Source: Ensembl

negative regulation of apoptotic process

Inferred from mutant phenotype PubMed 16720880. Source: MGI

negative regulation of cardiac muscle tissue development

Inferred from electronic annotation. Source: Ensembl

negative regulation of neuron apoptotic process

Inferred from mutant phenotype PubMed 16245339. Source: MGI

neural plate morphogenesis

Inferred from mutant phenotype PubMed 16613831. Source: MGI

odontogenesis

Inferred from electronic annotation. Source: Ensembl

organ induction

Inferred from genetic interaction PubMed 15741321. Source: MGI

otic vesicle formation

Inferred from genetic interaction PubMed 17601531. Source: MGI

outflow tract morphogenesis

Inferred from genetic interaction PubMed 21364285. Source: MGI

outflow tract septum morphogenesis

Inferred from genetic interaction PubMed 20807544. Source: UniProtKB

pallium development

Inferred from mutant phenotype PubMed 16613831. Source: MGI

patterning of blood vessels

Inferred from genetic interaction PubMed 15996652. Source: MGI

pharyngeal system development

Inferred from genetic interaction PubMed 21364285. Source: MGI

positive regulation of cell division

Inferred from electronic annotation. Source: UniProtKB-KW

positive regulation of cell proliferation

Inferred from direct assay PubMed 10381577PubMed 9463347. Source: MGI

positive regulation of gene expression

Inferred from direct assay PubMed 9244299PubMed 9847236. Source: MGI

positive regulation of mitosis

Inferred from direct assay PubMed 12783783. Source: MGI

positive regulation of organ growth

Inferred from mutant phenotype PubMed 19389367. Source: MGI

regulation of odontogenesis of dentin-containing tooth

Inferred from genetic interaction PubMed 9244299. Source: MGI

response to drug

Inferred from electronic annotation. Source: Ensembl

response to organic cyclic compound

Inferred from electronic annotation. Source: Ensembl

response to oxidative stress

Inferred from electronic annotation. Source: Ensembl

signal transduction involved in regulation of gene expression

Inferred from direct assay PubMed 18462699. Source: MGI

subpallium development

Inferred from mutant phenotype PubMed 16613831. Source: MGI

telencephalon development

Inferred from mutant phenotype PubMed 16613831. Source: MGI

thyroid gland development

Inferred from mutant phenotype PubMed 19389367. Source: MGI

thyroid-stimulating hormone-secreting cell differentiation

Inferred from direct assay PubMed 9463347. Source: MGI

   Cellular_componentexternal side of plasma membrane

Inferred from electronic annotation. Source: Ensembl

extracellular space

Inferred from electronic annotation. Source: Ensembl

   Molecular_functionchemoattractant activity

Inferred from electronic annotation. Source: Ensembl

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform FGF-8C (identifier: P37237-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform FGF-8B (identifier: P37237-2)

The sequence of this isoform differs from the canonical sequence as follows:
     24-87: VRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQR → VTVQSSPNFTQ
Isoform FGF-8A (identifier: P37237-3)

The sequence of this isoform differs from the canonical sequence as follows:
     24-87: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2222 Potential
Chain23 – 268246Fibroblast growth factor 8
PRO_0000008971

Amino acid modifications

Modified residue231Pyrrolidone carboxylic acid Potential
Glycosylation601N-linked (GlcNAc...) Potential
Glycosylation1901N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence24 – 8764Missing in isoform FGF-8A.
VSP_001528
Alternative sequence24 – 8764VRSAA…KVTQR → VTVQSSPNFTQ in isoform FGF-8B.
VSP_001527

Sequences

Sequence LengthMass (Da)Tools
Isoform FGF-8C [UniParc].

Last modified October 1, 1994. Version 1.
Checksum: 3330A9F342AD7109

FASTA26830,420
        10         20         30         40         50         60 
MGSPRSALSC LLLHLLVLCL QAQVRSAAQK RGPGAGNPAD TLGQGHEDRP FGQRSRAGKN 

        70         80         90        100        110        120 
FTNPAPNYPE EGSKEQRDSV LPKVTQRHVR EQSLVTDQLS RRLIRTYQLY SRTSGKHVQV 

       130        140        150        160        170        180 
LANKRINAMA EDGDPFAKLI VETDTFGSRV RVRGAETGLY ICMNKKGKLI AKSNGKGKDC 

       190        200        210        220        230        240 
VFTEIVLENN YTALQNAKYE GWYMAFTRKG RPRKGSKTRQ HQREVHFMKR LPRGHHTTEQ 

       250        260 
SLRFEFLNYP PFTRSLRGSQ RTWAPEPR 

« Hide

Isoform FGF-8B [UniParc].

Checksum: A39424271EF7CBFF
Show »

FASTA21524,711
Isoform FGF-8A [UniParc].

Checksum: 9A4CAB7686A2B190
Show »

FASTA20423,522

References

[1]"Cloning and characterization of an androgen-induced growth factor essential for the androgen-dependent growth of mouse mammary carcinoma cells."
Tanaka A., Miyamoto K., Minamino N., Takeda M., Sato B., Matsuo H., Matsumoto K.
Proc. Natl. Acad. Sci. U.S.A. 89:8928-8932(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE.
[2]"Fgf-8, activated by proviral insertion, cooperates with the Wnt-1 transgene in murine mammary tumorigenesis."
Macarthur C.A., Shankar D.B., Shackleford G.M.
J. Virol. 69:2501-2507(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Tissue: Mammary carcinoma.
[3]"A role for FGF-8 in the initiation and maintenance of vertebrate limb bud outgrowth."
Mahmood R., Bresnick J., Hornbruch A., Mahony C., Morton N., Colquhoun K., Martin P., Lumsden A., Dickson C., Mason I.
Curr. Biol. 5:797-806(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D12483 mRNA. Translation: BAA02051.1.
D12482 mRNA. Translation: BAA02050.1.
U18673 mRNA. Translation: AAA65387.1.
Z48746 mRNA. Translation: CAA88637.1.
PIRA46245.
B46245.
RefSeqNP_001159834.1. NM_001166362.1.
NP_001159835.1. NM_001166363.1.
NP_034335.1. NM_010205.2.
UniGeneMm.4012.

3D structure databases

ProteinModelPortalP37237.
SMRP37237. Positions 87-233.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

DIPDIP-6030N.
STRING10090.ENSMUSP00000026241.

PTM databases

PhosphoSiteP37237.

Proteomic databases

PRIDEP37237.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000026241; ENSMUSP00000026241; ENSMUSG00000025219. [P37237-1]
ENSMUST00000111927; ENSMUSP00000107558; ENSMUSG00000025219. [P37237-3]
ENSMUST00000111928; ENSMUSP00000107559; ENSMUSG00000025219. [P37237-2]
GeneID14179.
KEGGmmu:14179.
UCSCuc008hrh.2. mouse. [P37237-3]
uc012bmo.1. mouse. [P37237-1]

Organism-specific databases

CTD2253.
MGIMGI:99604. Fgf8.

Phylogenomic databases

eggNOGNOG327940.
GeneTreeENSGT00730000110785.
HOGENOMHOG000115986.
HOVERGENHBG005659.
InParanoidP37237.
KOK04358.
PhylomeDBP37237.
TreeFamTF331233.

Gene expression databases

BgeeP37237.
CleanExMM_FGF8.
GenevestigatorP37237.

Family and domain databases

InterProIPR008996. Cytokine_IL1-like.
IPR028249. FGF8.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF2. PTHR11486:SF2. 1 hit.
PfamPF00167. FGF. 1 hit.
[Graphical view]
PRINTSPR00262. IL1HBGF.
SMARTSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMSSF50353. SSF50353. 1 hit.
PROSITEPS00247. HBGF_FGF. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio285366.
PROP37237.
SOURCESearch...

Entry information

Entry nameFGF8_MOUSE
AccessionPrimary (citable) accession number: P37237
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: October 1, 1994
Last modified: April 16, 2014
This is version 125 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot