Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P37237

- FGF8_MOUSE

UniProt

P37237 - FGF8_MOUSE

Protein

Fibroblast growth factor 8

Gene

Fgf8

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 130 (01 Oct 2014)
      Sequence version 1 (01 Oct 1994)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system By similarity. Cooperates with Wnt-1 in mouse mammary tumor virus-induced murine mammary tumorigenesis.By similarity

    GO - Molecular functioni

    1. chemoattractant activity Source: Ensembl

    GO - Biological processi

    1. aorta morphogenesis Source: MGI
    2. apoptotic process Source: MGI
    3. blood vessel remodeling Source: MGI
    4. BMP signaling pathway Source: MGI
    5. bone development Source: Ensembl
    6. branching involved in salivary gland morphogenesis Source: MGI
    7. branching involved in ureteric bud morphogenesis Source: MGI
    8. canonical Wnt signaling pathway Source: MGI
    9. cell fate commitment Source: MGI
    10. cell migration involved in mesendoderm migration Source: MGI
    11. cell proliferation in forebrain Source: MGI
    12. corticotropin hormone secreting cell differentiation Source: MGI
    13. determination of left/right symmetry Source: MGI
    14. dopaminergic neuron differentiation Source: Ensembl
    15. dorsal/ventral axon guidance Source: Ensembl
    16. embryo development ending in birth or egg hatching Source: MGI
    17. embryonic heart tube development Source: MGI
    18. embryonic hindlimb morphogenesis Source: MGI
    19. epithelial to mesenchymal transition involved in endocardial cushion formation Source: BHF-UCL
    20. fibroblast growth factor receptor signaling pathway Source: MGI
    21. forebrain dorsal/ventral pattern formation Source: MGI
    22. forebrain morphogenesis Source: MGI
    23. forebrain neuron development Source: Ensembl
    24. generation of neurons Source: MGI
    25. gonad development Source: Ensembl
    26. heart development Source: MGI
    27. heart looping Source: MGI
    28. heart morphogenesis Source: MGI
    29. inner ear morphogenesis Source: MGI
    30. kidney development Source: MGI
    31. limb morphogenesis Source: MGI
    32. lung development Source: MGI
    33. lung morphogenesis Source: MGI
    34. male genitalia development Source: MGI
    35. MAPK cascade Source: MGI
    36. mesodermal cell migration Source: MGI
    37. mesonephros development Source: Ensembl
    38. metanephros development Source: Ensembl
    39. midbrain-hindbrain boundary development Source: MGI
    40. motor neuron axon guidance Source: Ensembl
    41. negative regulation of apoptotic process Source: MGI
    42. negative regulation of cardiac muscle tissue development Source: Ensembl
    43. negative regulation of neuron apoptotic process Source: MGI
    44. neural plate morphogenesis Source: MGI
    45. odontogenesis Source: Ensembl
    46. organ induction Source: MGI
    47. otic vesicle formation Source: MGI
    48. outflow tract morphogenesis Source: MGI
    49. outflow tract septum morphogenesis Source: UniProtKB
    50. pallium development Source: MGI
    51. patterning of blood vessels Source: MGI
    52. pharyngeal system development Source: MGI
    53. positive regulation of cell division Source: UniProtKB-KW
    54. positive regulation of cell proliferation Source: MGI
    55. positive regulation of gene expression Source: MGI
    56. positive regulation of mitosis Source: MGI
    57. positive regulation of organ growth Source: MGI
    58. regulation of odontogenesis of dentin-containing tooth Source: MGI
    59. response to drug Source: Ensembl
    60. response to organic cyclic compound Source: Ensembl
    61. response to oxidative stress Source: Ensembl
    62. signal transduction involved in regulation of gene expression Source: MGI
    63. subpallium development Source: MGI
    64. telencephalon development Source: MGI
    65. thyroid gland development Source: MGI
    66. thyroid-stimulating hormone-secreting cell differentiation Source: MGI

    Keywords - Molecular functioni

    Developmental protein, Growth factor, Mitogen

    Keywords - Biological processi

    Differentiation

    Enzyme and pathway databases

    ReactomeiREACT_196455. Signaling by FGFR mutants.
    REACT_196505. Signaling by FGFR3 mutants.
    REACT_196507. Signaling by activated point mutants of FGFR3.
    REACT_196536. Activated point mutants of FGFR2.
    REACT_196538. Signaling by activated point mutants of FGFR1.
    REACT_196588. Constitutive PI3K/AKT Signaling in Cancer.
    REACT_198525. Negative regulation of FGFR signaling.
    REACT_206694. FGFR4 ligand binding and activation.
    REACT_206745. FGFR2c ligand binding and activation.
    REACT_213224. FGFR3b ligand binding and activation.
    REACT_220750. FGFR3c ligand binding and activation.
    REACT_223993. PI-3K cascade.
    REACT_225874. FGFR1c ligand binding and activation.
    REACT_226341. PIP3 activates AKT signaling.
    REACT_94437. SHC-mediated cascade.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Fibroblast growth factor 8
    Short name:
    FGF-8
    Alternative name(s):
    Androgen-induced growth factor
    Short name:
    AIGF
    Heparin-binding growth factor 8
    Short name:
    HBGF-8
    Gene namesi
    Name:Fgf8
    Synonyms:Aigf
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 19

    Organism-specific databases

    MGIiMGI:99604. Fgf8.

    Subcellular locationi

    GO - Cellular componenti

    1. external side of plasma membrane Source: Ensembl
    2. extracellular space Source: Ensembl

    Keywords - Cellular componenti

    Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2222Sequence AnalysisAdd
    BLAST
    Chaini23 – 268246Fibroblast growth factor 8PRO_0000008971Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei23 – 231Pyrrolidone carboxylic acidSequence Analysis
    Glycosylationi60 – 601N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi190 – 1901N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    The N-terminus is blocked.

    Keywords - PTMi

    Glycoprotein, Pyrrolidone carboxylic acid

    Proteomic databases

    PRIDEiP37237.

    PTM databases

    PhosphoSiteiP37237.

    Expressioni

    Tissue specificityi

    Absent in normal mammary glands and detected only in adult testis and ovary and in midgestational embryos.

    Inductioni

    By androgens.

    Gene expression databases

    BgeeiP37237.
    CleanExiMM_FGF8.
    GenevestigatoriP37237.

    Interactioni

    Subunit structurei

    Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors By similarity.By similarity

    Protein-protein interaction databases

    DIPiDIP-6030N.
    STRINGi10090.ENSMUSP00000026241.

    Structurei

    3D structure databases

    ProteinModelPortaliP37237.
    SMRiP37237. Positions 87-233.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG327940.
    GeneTreeiENSGT00730000110785.
    HOGENOMiHOG000115986.
    HOVERGENiHBG005659.
    InParanoidiP37237.
    KOiK04358.
    OMAiGHEDRPF.
    PhylomeDBiP37237.
    TreeFamiTF331233.

    Family and domain databases

    InterProiIPR008996. Cytokine_IL1-like.
    IPR028249. FGF8.
    IPR002209. Fibroblast_GF_fam.
    IPR028142. IL-1_fam/FGF_fam.
    [Graphical view]
    PANTHERiPTHR11486. PTHR11486. 1 hit.
    PTHR11486:SF3. PTHR11486:SF3. 1 hit.
    PfamiPF00167. FGF. 1 hit.
    [Graphical view]
    PRINTSiPR00262. IL1HBGF.
    SMARTiSM00442. FGF. 1 hit.
    [Graphical view]
    SUPFAMiSSF50353. SSF50353. 1 hit.
    PROSITEiPS00247. HBGF_FGF. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform FGF-8C (identifier: P37237-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGSPRSALSC LLLHLLVLCL QAQVRSAAQK RGPGAGNPAD TLGQGHEDRP    50
    FGQRSRAGKN FTNPAPNYPE EGSKEQRDSV LPKVTQRHVR EQSLVTDQLS 100
    RRLIRTYQLY SRTSGKHVQV LANKRINAMA EDGDPFAKLI VETDTFGSRV 150
    RVRGAETGLY ICMNKKGKLI AKSNGKGKDC VFTEIVLENN YTALQNAKYE 200
    GWYMAFTRKG RPRKGSKTRQ HQREVHFMKR LPRGHHTTEQ SLRFEFLNYP 250
    PFTRSLRGSQ RTWAPEPR 268
    Length:268
    Mass (Da):30,420
    Last modified:October 1, 1994 - v1
    Checksum:i3330A9F342AD7109
    GO
    Isoform FGF-8B (identifier: P37237-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         24-87: VRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQR → VTVQSSPNFTQ

    Show »
    Length:215
    Mass (Da):24,711
    Checksum:iA39424271EF7CBFF
    GO
    Isoform FGF-8A (identifier: P37237-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         24-87: Missing.

    Show »
    Length:204
    Mass (Da):23,522
    Checksum:i9A4CAB7686A2B190
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei24 – 8764Missing in isoform FGF-8A. CuratedVSP_001528Add
    BLAST
    Alternative sequencei24 – 8764VRSAA…KVTQR → VTVQSSPNFTQ in isoform FGF-8B. CuratedVSP_001527Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D12483 mRNA. Translation: BAA02051.1.
    D12482 mRNA. Translation: BAA02050.1.
    U18673 mRNA. Translation: AAA65387.1.
    Z48746 mRNA. Translation: CAA88637.1.
    CCDSiCCDS29864.1. [P37237-1]
    CCDS50450.1. [P37237-3]
    CCDS50451.1. [P37237-2]
    PIRiA46245.
    B46245.
    RefSeqiNP_001159834.1. NM_001166362.1. [P37237-2]
    NP_001159835.1. NM_001166363.1. [P37237-3]
    NP_034335.1. NM_010205.2. [P37237-1]
    UniGeneiMm.4012.

    Genome annotation databases

    EnsembliENSMUST00000026241; ENSMUSP00000026241; ENSMUSG00000025219. [P37237-1]
    ENSMUST00000111927; ENSMUSP00000107558; ENSMUSG00000025219. [P37237-3]
    ENSMUST00000111928; ENSMUSP00000107559; ENSMUSG00000025219. [P37237-2]
    GeneIDi14179.
    KEGGimmu:14179.
    UCSCiuc008hrh.2. mouse. [P37237-3]
    uc012bmo.1. mouse. [P37237-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D12483 mRNA. Translation: BAA02051.1 .
    D12482 mRNA. Translation: BAA02050.1 .
    U18673 mRNA. Translation: AAA65387.1 .
    Z48746 mRNA. Translation: CAA88637.1 .
    CCDSi CCDS29864.1. [P37237-1 ]
    CCDS50450.1. [P37237-3 ]
    CCDS50451.1. [P37237-2 ]
    PIRi A46245.
    B46245.
    RefSeqi NP_001159834.1. NM_001166362.1. [P37237-2 ]
    NP_001159835.1. NM_001166363.1. [P37237-3 ]
    NP_034335.1. NM_010205.2. [P37237-1 ]
    UniGenei Mm.4012.

    3D structure databases

    ProteinModelPortali P37237.
    SMRi P37237. Positions 87-233.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    DIPi DIP-6030N.
    STRINGi 10090.ENSMUSP00000026241.

    PTM databases

    PhosphoSitei P37237.

    Proteomic databases

    PRIDEi P37237.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000026241 ; ENSMUSP00000026241 ; ENSMUSG00000025219 . [P37237-1 ]
    ENSMUST00000111927 ; ENSMUSP00000107558 ; ENSMUSG00000025219 . [P37237-3 ]
    ENSMUST00000111928 ; ENSMUSP00000107559 ; ENSMUSG00000025219 . [P37237-2 ]
    GeneIDi 14179.
    KEGGi mmu:14179.
    UCSCi uc008hrh.2. mouse. [P37237-3 ]
    uc012bmo.1. mouse. [P37237-1 ]

    Organism-specific databases

    CTDi 2253.
    MGIi MGI:99604. Fgf8.

    Phylogenomic databases

    eggNOGi NOG327940.
    GeneTreei ENSGT00730000110785.
    HOGENOMi HOG000115986.
    HOVERGENi HBG005659.
    InParanoidi P37237.
    KOi K04358.
    OMAi GHEDRPF.
    PhylomeDBi P37237.
    TreeFami TF331233.

    Enzyme and pathway databases

    Reactomei REACT_196455. Signaling by FGFR mutants.
    REACT_196505. Signaling by FGFR3 mutants.
    REACT_196507. Signaling by activated point mutants of FGFR3.
    REACT_196536. Activated point mutants of FGFR2.
    REACT_196538. Signaling by activated point mutants of FGFR1.
    REACT_196588. Constitutive PI3K/AKT Signaling in Cancer.
    REACT_198525. Negative regulation of FGFR signaling.
    REACT_206694. FGFR4 ligand binding and activation.
    REACT_206745. FGFR2c ligand binding and activation.
    REACT_213224. FGFR3b ligand binding and activation.
    REACT_220750. FGFR3c ligand binding and activation.
    REACT_223993. PI-3K cascade.
    REACT_225874. FGFR1c ligand binding and activation.
    REACT_226341. PIP3 activates AKT signaling.
    REACT_94437. SHC-mediated cascade.

    Miscellaneous databases

    NextBioi 285366.
    PROi P37237.
    SOURCEi Search...

    Gene expression databases

    Bgeei P37237.
    CleanExi MM_FGF8.
    Genevestigatori P37237.

    Family and domain databases

    InterProi IPR008996. Cytokine_IL1-like.
    IPR028249. FGF8.
    IPR002209. Fibroblast_GF_fam.
    IPR028142. IL-1_fam/FGF_fam.
    [Graphical view ]
    PANTHERi PTHR11486. PTHR11486. 1 hit.
    PTHR11486:SF3. PTHR11486:SF3. 1 hit.
    Pfami PF00167. FGF. 1 hit.
    [Graphical view ]
    PRINTSi PR00262. IL1HBGF.
    SMARTi SM00442. FGF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50353. SSF50353. 1 hit.
    PROSITEi PS00247. HBGF_FGF. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of an androgen-induced growth factor essential for the androgen-dependent growth of mouse mammary carcinoma cells."
      Tanaka A., Miyamoto K., Minamino N., Takeda M., Sato B., Matsuo H., Matsumoto K.
      Proc. Natl. Acad. Sci. U.S.A. 89:8928-8932(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], PARTIAL PROTEIN SEQUENCE.
    2. "Fgf-8, activated by proviral insertion, cooperates with the Wnt-1 transgene in murine mammary tumorigenesis."
      Macarthur C.A., Shankar D.B., Shackleford G.M.
      J. Virol. 69:2501-2507(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
      Tissue: Mammary carcinoma.
    3. "A role for FGF-8 in the initiation and maintenance of vertebrate limb bud outgrowth."
      Mahmood R., Bresnick J., Hornbruch A., Mahony C., Morton N., Colquhoun K., Martin P., Lumsden A., Dickson C., Mason I.
      Curr. Biol. 5:797-806(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].

    Entry informationi

    Entry nameiFGF8_MOUSE
    AccessioniPrimary (citable) accession number: P37237
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1994
    Last sequence update: October 1, 1994
    Last modified: October 1, 2014
    This is version 130 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3