Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P37136

- ACES_RAT

UniProt

P37136 - ACES_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Acetylcholinesterase

Gene

Ache

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft.

Catalytic activityi

Acetylcholine + H2O = choline + acetate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei234 – 2341Acyl-ester intermediatePROSITE-ProRule annotation
Active sitei365 – 3651Charge relay systemBy similarity
Active sitei478 – 4781Charge relay systemBy similarity

GO - Molecular functioni

  1. acetylcholine binding Source: RGD
  2. acetylcholinesterase activity Source: RGD
  3. choline binding Source: RGD
  4. cholinesterase activity Source: RefGenome

GO - Biological processi

  1. acetylcholine catabolic process Source: RGD
  2. acetylcholine metabolic process Source: RGD
  3. choline metabolic process Source: RGD
  4. neuron death Source: RGD
  5. positive regulation of axonogenesis Source: RGD
  6. positive regulation of dendrite morphogenesis Source: RGD
  7. synapse assembly Source: RGD
  8. synaptic transmission, cholinergic Source: RefGenome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Serine esterase

Keywords - Biological processi

Neurotransmitter degradation

Protein family/group databases

MEROPSiS09.979.

Names & Taxonomyi

Protein namesi
Recommended name:
Acetylcholinesterase (EC:3.1.1.7)
Short name:
AChE
Gene namesi
Name:Ache
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi69313. Ache.

Subcellular locationi

GO - Cellular componenti

  1. anchored component of membrane Source: UniProtKB-KW
  2. axon Source: RGD
  3. cell junction Source: UniProtKB-KW
  4. cell surface Source: RGD
  5. cytoplasm Source: RGD
  6. dendrite Source: RGD
  7. endoplasmic reticulum lumen Source: RGD
  8. extracellular space Source: RefGenome
  9. Golgi apparatus Source: RGD
  10. neuromuscular junction Source: RefGenome
  11. neuronal cell body Source: RGD
  12. neuron projection Source: RGD
  13. nuclear envelope Source: RGD
  14. perinuclear region of cytoplasm Source: RGD
  15. plasma membrane Source: RGD
  16. postsynaptic membrane Source: RGD
  17. presynaptic membrane Source: RGD
  18. rough endoplasmic reticulum Source: RGD
  19. synapse Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Secreted, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3131Sequence AnalysisAdd
BLAST
Chaini32 – 614583AcetylcholinesterasePRO_0000008590Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi100 ↔ 127By similarity
Disulfide bondi288 ↔ 303By similarity
Glycosylationi296 – 2961N-linked (GlcNAc...)Sequence Analysis
Glycosylationi381 – 3811N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi440 ↔ 560By similarity
Glycosylationi495 – 4951N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi611 – 611InterchainBy similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

PRIDEiP37136.

Expressioni

Tissue specificityi

Has been found in central nervous system and muscle. Found in embryonic liver and spleen but not in adult liver.

Gene expression databases

GenevestigatoriP37136.

Interactioni

Subunit structurei

Homotetramer; composed of disulfide-linked homodimers. Catalytic forms H (GPI-anchor dimer) and T (asymmetric collagen-tailed), which differ in their C-terminus, account for all types of known ACHE forms. Interacts with PRIMA1. The interaction with PRIMA1 is required to anchor it to the basal lamina of cells and organize into tetramers (By similarity).By similarity

Structurei

3D structure databases

ProteinModelPortaliP37136.
SMRiP37136. Positions 36-608.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

HOVERGENiHBG008839.
InParanoidiP37136.
KOiK01049.
PhylomeDBiP37136.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR014788. AChE_tetra.
IPR002018. CarbesteraseB.
IPR019826. Carboxylesterase_B_AS.
IPR019819. Carboxylesterase_B_CS.
IPR000997. Cholinesterase.
[Graphical view]
PfamiPF08674. AChE_tetra. 1 hit.
PF00135. COesterase. 1 hit.
[Graphical view]
PRINTSiPR00878. CHOLNESTRASE.
ProDomiPD415333. AChE_tetra. 1 hit.
[Graphical view] [Entries sharing at least one domain]
SUPFAMiSSF53474. SSF53474. 1 hit.
PROSITEiPS00122. CARBOXYLESTERASE_B_1. 1 hit.
PS00941. CARBOXYLESTERASE_B_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform T (identifier: P37136-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRPPWYPLHT PSLASPLLFL LLSLLGGGAR AEGREDPQLL VRVRGGQLRG
60 70 80 90 100
IRLKAPGGPV SAFLGIPFAE PPVGSRRFMP PEPKRPWSGI LDATTFQNVC
110 120 130 140 150
YQYVDTLYPG FEGTEMWNPN RELSEDCLYL NVWTPYPRPT SPTPVLIWIY
160 170 180 190 200
GGGFYSGASS LDVYDGRFLA QVEGTVLVSM NYRVGTFGFL ALPGSREAPG
210 220 230 240 250
NVGLLDQRLA LQWVQENIAA FGGDPMSVTL FGESAGAASV GMHILSLPSR
260 270 280 290 300
SLFHRAVLQS GTPNGPWATV SAGEARRRAT LLARLVGCPP GGAGGNDTEL
310 320 330 340 350
ISCLRTRPAQ DLVDHEWHVL PQESIFRFSF VPVVDGDFLS DTPDALINTG
360 370 380 390 400
DFQDLQVLVG VVKDEGSYFL VYGVPGFSKD NESLISRAQF LAGVRIGVPQ
410 420 430 440 450
ASDLAAEAVV LHYTDWLHPE DPAHLRDAMS AVVGDHNVVC PVAQLAGRLA
460 470 480 490 500
AQGARVYAYI FEHRASTLTW PLWMGVPHGY EIEFIFGLPL DPSLNYTVEE
510 520 530 540 550
RIFAQRLMQY WTNFARTGDP NDPRDSKSPR WPPYTTAAQQ YVSLNLKPLE
560 570 580 590 600
VRRGLRAQTC AFWNRFLPKL LSATDTLDEA ERQWKAEFHR WSSYMVHWKN
610
QFDHYSKQER CSDL
Length:614
Mass (Da):68,196
Last modified:October 1, 1994 - v1
Checksum:i2EDAE7D46282E7C0
GO
Isoform H (identifier: P37136-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     575-614: DTLDEAERQW...YSKQERCSDL → ATEVPCTCPS...FLLHSGLRWL

Show »
Length:616
Mass (Da):67,582
Checksum:iDA2CB2026B1FFE38
GO
Isoform R (identifier: P37136-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     575-614: DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQERCSDL → GRRGVGKQGMHKAARVGRTGERKGGKHRM

Note: May be not functional.

Show »
Length:603
Mass (Da):66,268
Checksum:i16115C6C19815CFA
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei575 – 61440DTLDE…RCSDL → ATEVPCTCPSPAHGEAAPRP GPALSLSLLFFLFLLHSGLR WL in isoform H. 1 PublicationVSP_001458Add
BLAST
Alternative sequencei575 – 61440DTLDE…RCSDL → GRRGVGKQGMHKAARVGRTG ERKGGKHRM in isoform R. 1 PublicationVSP_001459Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S50879 mRNA. Translation: AAB24586.1.
X70140 mRNA. Translation: CAA49717.1.
X70141 mRNA. Translation: CAA49718.1.
PIRiJH0811.
RefSeqiNP_742006.1. NM_172009.1. [P37136-1]
UniGeneiRn.105879.

Genome annotation databases

GeneIDi83817.
KEGGirno:83817.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S50879 mRNA. Translation: AAB24586.1 .
X70140 mRNA. Translation: CAA49717.1 .
X70141 mRNA. Translation: CAA49718.1 .
PIRi JH0811.
RefSeqi NP_742006.1. NM_172009.1. [P37136-1 ]
UniGenei Rn.105879.

3D structure databases

ProteinModelPortali P37136.
SMRi P37136. Positions 36-608.
ModBasei Search...
MobiDBi Search...

Chemistry

BindingDBi P37136.
ChEMBLi CHEMBL2111475.

Protein family/group databases

MEROPSi S09.979.

Proteomic databases

PRIDEi P37136.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 83817.
KEGGi rno:83817.

Organism-specific databases

CTDi 43.
RGDi 69313. Ache.

Phylogenomic databases

HOVERGENi HBG008839.
InParanoidi P37136.
KOi K01049.
PhylomeDBi P37136.

Miscellaneous databases

NextBioi 616425.
PROi P37136.

Gene expression databases

Genevestigatori P37136.

Family and domain databases

Gene3Di 3.40.50.1820. 1 hit.
InterProi IPR029058. AB_hydrolase.
IPR014788. AChE_tetra.
IPR002018. CarbesteraseB.
IPR019826. Carboxylesterase_B_AS.
IPR019819. Carboxylesterase_B_CS.
IPR000997. Cholinesterase.
[Graphical view ]
Pfami PF08674. AChE_tetra. 1 hit.
PF00135. COesterase. 1 hit.
[Graphical view ]
PRINTSi PR00878. CHOLNESTRASE.
ProDomi PD415333. AChE_tetra. 1 hit.
[Graphical view ] [Entries sharing at least one domain ]
SUPFAMi SSF53474. SSF53474. 1 hit.
PROSITEi PS00122. CARBOXYLESTERASE_B_1. 1 hit.
PS00941. CARBOXYLESTERASE_B_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Cloning and expression of a rat acetylcholinesterase subunit: generation of multiple molecular forms and complementarity with a Torpedo collagenic subunit."
    Legay C., Bon S., Vernier P., Coussen F., Massoulie J.
    J. Neurochem. 60:337-346(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM T).
  2. "Expression of a cDNA encoding the glycolipid-anchored form of rat acetylcholinesterase."
    Legay C., Bon S., Massoulie J.
    FEBS Lett. 315:163-166(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS H AND R).

Entry informationi

Entry nameiACES_RAT
AccessioniPrimary (citable) accession number: P37136
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: October 1, 1994
Last modified: October 29, 2014
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3