P37136 (ACES_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 94.
History...
Clusters with 
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Acetylcholinesterase Short name=AChE EC=3.1.1.7 | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 614 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft. |
| Catalytic activity | Acetylcholine + H2O = choline + acetate. |
| Subunit structure | Homotetramer; composed of disulfide-linked homodimers. Catalytic forms H (GPI-anchor dimer) and T (asymmetric collagen-tailed), which differ in their C-terminus, account for all types of known ACHE forms. Interacts with PRIMA1. The interaction with PRIMA1 is required to anchor it to the basal lamina of cells and organize into tetramers By similarity. |
| Subcellular location | Cell junction › synapse. Secreted. Cell membrane; Peripheral membrane protein By similarity. Isoform H: Cell membrane; Lipid-anchor › GPI-anchor; Extracellular side. |
| Tissue specificity | Has been found in central nervous system and muscle. Found in embryonic liver and spleen but not in adult liver. |
| Sequence similarities | Belongs to the type-B carboxylesterase/lipase family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform T (identifier: P37136-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform H (identifier: P37136-2) The sequence of this isoform differs from the canonical sequence as follows: 575-614: DTLDEAERQW...YSKQERCSDL → ATEVPCTCPS...FLLHSGLRWL | ||||||
| Isoform R (identifier: P37136-3) The sequence of this isoform differs from the canonical sequence as follows: 575-614: DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQERCSDL → GRRGVGKQGMHKAARVGRTGERKGGKHRM | ||||||
| Note: May be not functional. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 31 | 31 | Potential | ||||||||
| Chain | 32 – 614 | 583 | Acetylcholinesterase | PRO_0000008590 | |||||||
Sites | |||||||||||
| Active site | 234 | 1 | Acyl-ester intermediate By similarity | ||||||||
| Active site | 365 | 1 | Charge relay system By similarity | ||||||||
| Active site | 478 | 1 | Charge relay system By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 296 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 381 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 495 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 100 ↔ 127 | By similarity | |||||||||
| Disulfide bond | 288 ↔ 303 | By similarity | |||||||||
| Disulfide bond | 440 ↔ 560 | By similarity | |||||||||
| Disulfide bond | 611 | Interchain By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 575 – 614 | 40 | DTLDE…RCSDL → ATEVPCTCPSPAHGEAAPRP GPALSLSLLFFLFLLHSGLR WL in isoform H. | VSP_001458 | |||||||
| Alternative sequence | 575 – 614 | 40 | DTLDE…RCSDL → GRRGVGKQGMHKAARVGRTG ERKGGKHRM in isoform R. | VSP_001459 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Cloning and expression of a rat acetylcholinesterase subunit: generation of multiple molecular forms and complementarity with a Torpedo collagenic subunit." Legay C., Bon S., Vernier P., Coussen F., Massoulie J. J. Neurochem. 60:337-346(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM T). |
| [2] | "Expression of a cDNA encoding the glycolipid-anchored form of rat acetylcholinesterase." Legay C., Bon S., Massoulie J. FEBS Lett. 315:163-166(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS H AND R). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | S50879 mRNA. Translation: AAB24586.1. X70140 mRNA. Translation: CAA49717.1. X70141 mRNA. Translation: CAA49718.1. |
| IPI | IPI00203357. IPI00231569. IPI00231570. |
| PIR | JH0811. |
| RefSeq | NP_742006.1. NM_172009.1. |
| UniGene | Rn.105879. |
3D structure databases | |
| ProteinModelPortal | P37136. |
| SMR | P37136. Positions 36-608. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | S09.979. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 83817. |
| KEGG | rno:83817. |
Organism-specific databases | |
| CTD | 43. |
| RGD | 69313. Ache. |
Phylogenomic databases | |
| HOVERGEN | HBG008839. |
| KO | K01049. |
Gene expression databases | |
| Genevestigator | P37136. |
Family and domain databases | |
| InterPro | IPR014788. AChE_tetra. IPR002018. CarbesteraseB. IPR019826. Carboxylesterase_B_AS. IPR019819. Carboxylesterase_B_CS. IPR000997. Cholinesterase. [Graphical view] |
| Pfam | PF08674. AChE_tetra. 1 hit. PF00135. COesterase. 1 hit. [Graphical view] |
| PRINTS | PR00878. CHOLNESTRASE. |
| ProDom | PD415333. AChE_tetra. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| PROSITE | PS00122. CARBOXYLESTERASE_B_1. 1 hit. PS00941. CARBOXYLESTERASE_B_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P37136. |
| ChEMBL | CHEMBL3199. |
| NextBio | 616425. |
Entry information
| Entry name | ACES_RAT | ||||||||
| Accession | Primary (citable) accession number: P37136 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |