Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P37136

- ACES_RAT

UniProt

P37136 - ACES_RAT

Protein

Acetylcholinesterase

Gene

Ache

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 103 (01 Oct 2014)
      Sequence version 1 (01 Oct 1994)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft.

    Catalytic activityi

    Acetylcholine + H2O = choline + acetate.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei234 – 2341Acyl-ester intermediatePROSITE-ProRule annotation
    Active sitei365 – 3651Charge relay systemBy similarity
    Active sitei478 – 4781Charge relay systemBy similarity

    GO - Molecular functioni

    1. acetylcholine binding Source: RGD
    2. acetylcholinesterase activity Source: RGD
    3. choline binding Source: RGD
    4. cholinesterase activity Source: RefGenome

    GO - Biological processi

    1. acetylcholine catabolic process Source: RGD
    2. acetylcholine metabolic process Source: RGD
    3. choline metabolic process Source: RGD
    4. neuron death Source: RGD
    5. positive regulation of axonogenesis Source: RGD
    6. positive regulation of dendrite morphogenesis Source: RGD
    7. synapse assembly Source: RGD
    8. synaptic transmission, cholinergic Source: RefGenome

    Keywords - Molecular functioni

    Hydrolase, Serine esterase

    Keywords - Biological processi

    Neurotransmitter degradation

    Protein family/group databases

    MEROPSiS09.979.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Acetylcholinesterase (EC:3.1.1.7)
    Short name:
    AChE
    Gene namesi
    Name:Ache
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi69313. Ache.

    Subcellular locationi

    GO - Cellular componenti

    1. anchored component of membrane Source: UniProtKB-KW
    2. axon Source: RGD
    3. cell junction Source: UniProtKB-KW
    4. cell surface Source: RGD
    5. cytoplasm Source: RGD
    6. dendrite Source: RGD
    7. endoplasmic reticulum lumen Source: RGD
    8. extracellular space Source: RefGenome
    9. Golgi apparatus Source: RGD
    10. neuromuscular junction Source: RefGenome
    11. neuronal cell body Source: RGD
    12. neuron projection Source: RGD
    13. nuclear envelope Source: RGD
    14. perinuclear region of cytoplasm Source: RGD
    15. plasma membrane Source: RGD
    16. postsynaptic membrane Source: RGD
    17. presynaptic membrane Source: RGD
    18. rough endoplasmic reticulum Source: RGD
    19. synapse Source: RGD

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Secreted, Synapse

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3131Sequence AnalysisAdd
    BLAST
    Chaini32 – 614583AcetylcholinesterasePRO_0000008590Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi100 ↔ 127By similarity
    Disulfide bondi288 ↔ 303By similarity
    Glycosylationi296 – 2961N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi381 – 3811N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi440 ↔ 560By similarity
    Glycosylationi495 – 4951N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi611 – 611InterchainBy similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

    Proteomic databases

    PRIDEiP37136.

    Expressioni

    Tissue specificityi

    Has been found in central nervous system and muscle. Found in embryonic liver and spleen but not in adult liver.

    Gene expression databases

    GenevestigatoriP37136.

    Interactioni

    Subunit structurei

    Homotetramer; composed of disulfide-linked homodimers. Catalytic forms H (GPI-anchor dimer) and T (asymmetric collagen-tailed), which differ in their C-terminus, account for all types of known ACHE forms. Interacts with PRIMA1. The interaction with PRIMA1 is required to anchor it to the basal lamina of cells and organize into tetramers By similarity.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliP37136.
    SMRiP37136. Positions 36-608.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal

    Phylogenomic databases

    HOVERGENiHBG008839.
    KOiK01049.
    PhylomeDBiP37136.

    Family and domain databases

    Gene3Di3.40.50.1820. 1 hit.
    InterProiIPR029058. AB_hydrolase.
    IPR014788. AChE_tetra.
    IPR002018. CarbesteraseB.
    IPR019826. Carboxylesterase_B_AS.
    IPR019819. Carboxylesterase_B_CS.
    IPR000997. Cholinesterase.
    [Graphical view]
    PfamiPF08674. AChE_tetra. 1 hit.
    PF00135. COesterase. 1 hit.
    [Graphical view]
    PRINTSiPR00878. CHOLNESTRASE.
    ProDomiPD415333. AChE_tetra. 1 hit.
    [Graphical view] [Entries sharing at least one domain]
    SUPFAMiSSF53474. SSF53474. 1 hit.
    PROSITEiPS00122. CARBOXYLESTERASE_B_1. 1 hit.
    PS00941. CARBOXYLESTERASE_B_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform T (identifier: P37136-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRPPWYPLHT PSLASPLLFL LLSLLGGGAR AEGREDPQLL VRVRGGQLRG    50
    IRLKAPGGPV SAFLGIPFAE PPVGSRRFMP PEPKRPWSGI LDATTFQNVC 100
    YQYVDTLYPG FEGTEMWNPN RELSEDCLYL NVWTPYPRPT SPTPVLIWIY 150
    GGGFYSGASS LDVYDGRFLA QVEGTVLVSM NYRVGTFGFL ALPGSREAPG 200
    NVGLLDQRLA LQWVQENIAA FGGDPMSVTL FGESAGAASV GMHILSLPSR 250
    SLFHRAVLQS GTPNGPWATV SAGEARRRAT LLARLVGCPP GGAGGNDTEL 300
    ISCLRTRPAQ DLVDHEWHVL PQESIFRFSF VPVVDGDFLS DTPDALINTG 350
    DFQDLQVLVG VVKDEGSYFL VYGVPGFSKD NESLISRAQF LAGVRIGVPQ 400
    ASDLAAEAVV LHYTDWLHPE DPAHLRDAMS AVVGDHNVVC PVAQLAGRLA 450
    AQGARVYAYI FEHRASTLTW PLWMGVPHGY EIEFIFGLPL DPSLNYTVEE 500
    RIFAQRLMQY WTNFARTGDP NDPRDSKSPR WPPYTTAAQQ YVSLNLKPLE 550
    VRRGLRAQTC AFWNRFLPKL LSATDTLDEA ERQWKAEFHR WSSYMVHWKN 600
    QFDHYSKQER CSDL 614
    Length:614
    Mass (Da):68,196
    Last modified:October 1, 1994 - v1
    Checksum:i2EDAE7D46282E7C0
    GO
    Isoform H (identifier: P37136-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         575-614: DTLDEAERQW...YSKQERCSDL → ATEVPCTCPS...FLLHSGLRWL

    Show »
    Length:616
    Mass (Da):67,582
    Checksum:iDA2CB2026B1FFE38
    GO
    Isoform R (identifier: P37136-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         575-614: DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQERCSDL → GRRGVGKQGMHKAARVGRTGERKGGKHRM

    Note: May be not functional.

    Show »
    Length:603
    Mass (Da):66,268
    Checksum:i16115C6C19815CFA
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei575 – 61440DTLDE…RCSDL → ATEVPCTCPSPAHGEAAPRP GPALSLSLLFFLFLLHSGLR WL in isoform H. 1 PublicationVSP_001458Add
    BLAST
    Alternative sequencei575 – 61440DTLDE…RCSDL → GRRGVGKQGMHKAARVGRTG ERKGGKHRM in isoform R. 1 PublicationVSP_001459Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    S50879 mRNA. Translation: AAB24586.1.
    X70140 mRNA. Translation: CAA49717.1.
    X70141 mRNA. Translation: CAA49718.1.
    PIRiJH0811.
    RefSeqiNP_742006.1. NM_172009.1. [P37136-1]
    UniGeneiRn.105879.

    Genome annotation databases

    GeneIDi83817.
    KEGGirno:83817.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    S50879 mRNA. Translation: AAB24586.1 .
    X70140 mRNA. Translation: CAA49717.1 .
    X70141 mRNA. Translation: CAA49718.1 .
    PIRi JH0811.
    RefSeqi NP_742006.1. NM_172009.1. [P37136-1 ]
    UniGenei Rn.105879.

    3D structure databases

    ProteinModelPortali P37136.
    SMRi P37136. Positions 36-608.
    ModBasei Search...
    MobiDBi Search...

    Chemistry

    BindingDBi P37136.
    ChEMBLi CHEMBL3199.

    Protein family/group databases

    MEROPSi S09.979.

    Proteomic databases

    PRIDEi P37136.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 83817.
    KEGGi rno:83817.

    Organism-specific databases

    CTDi 43.
    RGDi 69313. Ache.

    Phylogenomic databases

    HOVERGENi HBG008839.
    KOi K01049.
    PhylomeDBi P37136.

    Miscellaneous databases

    NextBioi 616425.
    PROi P37136.

    Gene expression databases

    Genevestigatori P37136.

    Family and domain databases

    Gene3Di 3.40.50.1820. 1 hit.
    InterProi IPR029058. AB_hydrolase.
    IPR014788. AChE_tetra.
    IPR002018. CarbesteraseB.
    IPR019826. Carboxylesterase_B_AS.
    IPR019819. Carboxylesterase_B_CS.
    IPR000997. Cholinesterase.
    [Graphical view ]
    Pfami PF08674. AChE_tetra. 1 hit.
    PF00135. COesterase. 1 hit.
    [Graphical view ]
    PRINTSi PR00878. CHOLNESTRASE.
    ProDomi PD415333. AChE_tetra. 1 hit.
    [Graphical view ] [Entries sharing at least one domain ]
    SUPFAMi SSF53474. SSF53474. 1 hit.
    PROSITEi PS00122. CARBOXYLESTERASE_B_1. 1 hit.
    PS00941. CARBOXYLESTERASE_B_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and expression of a rat acetylcholinesterase subunit: generation of multiple molecular forms and complementarity with a Torpedo collagenic subunit."
      Legay C., Bon S., Vernier P., Coussen F., Massoulie J.
      J. Neurochem. 60:337-346(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM T).
    2. "Expression of a cDNA encoding the glycolipid-anchored form of rat acetylcholinesterase."
      Legay C., Bon S., Massoulie J.
      FEBS Lett. 315:163-166(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS H AND R).

    Entry informationi

    Entry nameiACES_RAT
    AccessioniPrimary (citable) accession number: P37136
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1994
    Last sequence update: October 1, 1994
    Last modified: October 1, 2014
    This is version 103 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3