Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Acetylcholinesterase

Gene

Ache

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft.

Catalytic activityi

Acetylcholine + H2O = choline + acetate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei234Acyl-ester intermediatePROSITE-ProRule annotation1
Active sitei365Charge relay systemBy similarity1
Active sitei478Charge relay systemBy similarity1

GO - Molecular functioni

GO - Biological processi

  • acetylcholine catabolic process Source: RGD
  • acetylcholine catabolic process in synaptic cleft Source: SynGO
  • acetylcholine metabolic process Source: RGD
  • cell adhesion Source: RGD
  • choline metabolic process Source: RGD
  • neuron death Source: RGD
  • neurotransmitter receptor biosynthetic process Source: RGD
  • osteoblast development Source: RGD
  • positive regulation of axonogenesis Source: RGD
  • positive regulation of dendrite morphogenesis Source: RGD
  • protein tetramerization Source: RGD
  • receptor internalization Source: RGD
  • regulation of receptor recycling Source: RGD
  • retina development in camera-type eye Source: RGD
  • synapse assembly Source: RGD

Keywordsi

Molecular functionHydrolase, Serine esterase
Biological processNeurotransmitter degradation

Protein family/group databases

ESTHERiratno-ACHE. AChE.
MEROPSiS09.979.

Names & Taxonomyi

Protein namesi
Recommended name:
Acetylcholinesterase (EC:3.1.1.7)
Short name:
AChE
Gene namesi
Name:Ache
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi69313. Ache.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Secreted, Synapse

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL3199.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 31Sequence analysisAdd BLAST31
ChainiPRO_000000859032 – 614AcetylcholinesteraseAdd BLAST583

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi100 ↔ 127By similarity
Disulfide bondi288 ↔ 303By similarity
Glycosylationi296N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi381N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi440 ↔ 560By similarity
Glycosylationi495N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi611InterchainBy similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

PRIDEiP37136.

PTM databases

iPTMnetiP37136.
PhosphoSitePlusiP37136.

Expressioni

Tissue specificityi

Has been found in central nervous system and muscle. Found in embryonic liver and spleen but not in adult liver.

Interactioni

Subunit structurei

Homotetramer; composed of disulfide-linked homodimers. Catalytic forms H (GPI-anchor dimer) and T (asymmetric collagen-tailed), which differ in their C-terminus, account for all types of known ACHE forms. Interacts with PRIMA1. The interaction with PRIMA1 is required to anchor it to the basal lamina of cells and organize into tetramers (By similarity).By similarity

GO - Molecular functioni

Chemistry databases

BindingDBiP37136.

Structurei

3D structure databases

ProteinModelPortaliP37136.
SMRiP37136.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

HOVERGENiHBG008839.
InParanoidiP37136.
KOiK01049.
PhylomeDBiP37136.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiView protein in InterPro
IPR029058. AB_hydrolase.
IPR014788. AChE_tetra.
IPR002018. CarbesteraseB.
IPR019826. Carboxylesterase_B_AS.
IPR019819. Carboxylesterase_B_CS.
IPR000997. Cholinesterase.
PfamiView protein in Pfam
PF08674. AChE_tetra. 1 hit.
PF00135. COesterase. 1 hit.
PRINTSiPR00878. CHOLNESTRASE.
ProDomiView protein in ProDom or Entries sharing at least one domain
PD415333. AChE_tetra. 1 hit.
SUPFAMiSSF53474. SSF53474. 1 hit.
PROSITEiView protein in PROSITE
PS00122. CARBOXYLESTERASE_B_1. 1 hit.
PS00941. CARBOXYLESTERASE_B_2. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform T (identifier: P37136-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRPPWYPLHT PSLASPLLFL LLSLLGGGAR AEGREDPQLL VRVRGGQLRG
60 70 80 90 100
IRLKAPGGPV SAFLGIPFAE PPVGSRRFMP PEPKRPWSGI LDATTFQNVC
110 120 130 140 150
YQYVDTLYPG FEGTEMWNPN RELSEDCLYL NVWTPYPRPT SPTPVLIWIY
160 170 180 190 200
GGGFYSGASS LDVYDGRFLA QVEGTVLVSM NYRVGTFGFL ALPGSREAPG
210 220 230 240 250
NVGLLDQRLA LQWVQENIAA FGGDPMSVTL FGESAGAASV GMHILSLPSR
260 270 280 290 300
SLFHRAVLQS GTPNGPWATV SAGEARRRAT LLARLVGCPP GGAGGNDTEL
310 320 330 340 350
ISCLRTRPAQ DLVDHEWHVL PQESIFRFSF VPVVDGDFLS DTPDALINTG
360 370 380 390 400
DFQDLQVLVG VVKDEGSYFL VYGVPGFSKD NESLISRAQF LAGVRIGVPQ
410 420 430 440 450
ASDLAAEAVV LHYTDWLHPE DPAHLRDAMS AVVGDHNVVC PVAQLAGRLA
460 470 480 490 500
AQGARVYAYI FEHRASTLTW PLWMGVPHGY EIEFIFGLPL DPSLNYTVEE
510 520 530 540 550
RIFAQRLMQY WTNFARTGDP NDPRDSKSPR WPPYTTAAQQ YVSLNLKPLE
560 570 580 590 600
VRRGLRAQTC AFWNRFLPKL LSATDTLDEA ERQWKAEFHR WSSYMVHWKN
610
QFDHYSKQER CSDL
Length:614
Mass (Da):68,196
Last modified:October 1, 1994 - v1
Checksum:i2EDAE7D46282E7C0
GO
Isoform H (identifier: P37136-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     575-614: DTLDEAERQW...YSKQERCSDL → ATEVPCTCPS...FLLHSGLRWL

Show »
Length:616
Mass (Da):67,582
Checksum:iDA2CB2026B1FFE38
GO
Isoform R (identifier: P37136-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     575-614: DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQERCSDL → GRRGVGKQGMHKAARVGRTGERKGGKHRM

Note: May be not functional.
Show »
Length:603
Mass (Da):66,268
Checksum:i16115C6C19815CFA
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001458575 – 614DTLDE…RCSDL → ATEVPCTCPSPAHGEAAPRP GPALSLSLLFFLFLLHSGLR WL in isoform H. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_001459575 – 614DTLDE…RCSDL → GRRGVGKQGMHKAARVGRTG ERKGGKHRM in isoform R. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S50879 mRNA. Translation: AAB24586.1.
X70140 mRNA. Translation: CAA49717.1.
X70141 mRNA. Translation: CAA49718.1.
PIRiJH0811.
RefSeqiNP_742006.1. NM_172009.1. [P37136-1]
UniGeneiRn.105879.

Genome annotation databases

GeneIDi83817.
KEGGirno:83817.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiACES_RAT
AccessioniPrimary (citable) accession number: P37136
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: October 1, 1994
Last modified: November 22, 2017
This is version 121 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families