P37088 (SCNNA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 136.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Amiloride-sensitive sodium channel subunit alpha Alternative name(s): Alpha-NaCH Epithelial Na(+) channel subunit alpha Short name=Alpha-ENaC Short name=ENaCA Nonvoltage-gated sodium channel 1 subunit alpha SCNEA | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 669 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception. |
| Enzyme regulation | Activated by WNK1, WNK2, WNK3 and WNK4 By similarity. |
| Subunit structure | Probable heterotrimer containing one alpha, one beta and one gamma subunit. A delta subunit can replace the alpha subunit. Interacts with the WW domains of NEDD4, NEDD4L, WWP1 and WWP2. Interacts with the full length immature form of PCSK9 (pro-PCSK9). Ref.15 Ref.16 Ref.17 Ref.20 Ref.23 |
| Subcellular location | Apical cell membrane; Multi-pass membrane protein. Note: Apical membrane of epithelial cells. |
| Tissue specificity | Highly expressed in kidney and lung. Detected at intermediate levels in pancreas and liver, and at low levels in heart and placenta. Isoform 1 and isoform 2 predominate in all tissues. Expression of isoform 3, isoform 4 and isoform 5 is very low or not detectable, except in lung and heart. Ref.14 |
| Induction | By aldosterone. Ref.12 |
| Post-translational modification | Ubiquitinated; this targets individual subunits for endocytosis and proteasome-mediated degradation By similarity. ENaC cleavage by furin, and subsequently by prostasin (PRSS8), leads to a stepwise increase in the open probability of the channel as a result of release of the alpha and gamma subunit inhibitory tracts, respectively. |
| Involvement in disease | Pseudohypoaldosteronism 1, autosomal recessive (PHA1B) [MIM:264350]: A rare salt wasting disease resulting from target organ unresponsiveness to mineralocorticoids. PHA1B is a severe form involving multiple organ systems, and characterized by an often fulminant presentation in the neonatal period with dehydration, hyponatremia, hyperkalemia, metabolic acidosis, failure to thrive and weight loss. Bronchiectasis with or without elevated sweat chloride 2 (BESC2) [MIM:613021]: A debilitating respiratory disease characterized by chronic, abnormal dilatation of the bronchi and other cystic fibrosis-like symptoms in the absence of known causes of bronchiectasis (cystic fibrosis, autoimmune diseases, ciliary dyskinesia, common variable immunodeficiency, foreign body obstruction). Clinical features include sub-normal lung function, sinopulmonary infections, chronic productive cough, excessive sputum production, and elevated sweat chloride in some cases. |
| Sequence similarities | Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1A subfamily. [View classification] |
| Sequence caution | The sequence AAH06526.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P37088-1) Also known as: Alpha ENAC1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P37088-2) Also known as: Alpha ENAC2; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGMARGSLTRVPGVMGEGTQGPELSLDPDPCSPQSTPGLMKGNKLEEQDPRPLQPIPGLM | ||||||
| Isoform 3 (identifier: P37088-3) Also known as: Alpha ENACx; The sequence of this isoform differs from the canonical sequence as follows: 229-245: CNQNKSDCFYQTYSSGV → ELLSLPPPDVWKLLYFG 246-669: Missing. | ||||||
| Note: Does not give rise to amiloride-sensitive ion current. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: P37088-4) Also known as: Alpha ENAC-19; The sequence of this isoform differs from the canonical sequence as follows: 327-345: Missing. | ||||||
| Note: Amiloride-sensitive ion current is nearly abolished. | ||||||
| Isoform 5 (identifier: P37088-5) Also known as: Alpha ENAC+22; The sequence of this isoform differs from the canonical sequence as follows: 454-454: G → GQVRSLTPVIPALWEAEAGGSRG | ||||||
| Note: Does not give rise to amiloride-sensitive ion current. | ||||||
| Isoform 6 (identifier: P37088-6) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSSIKGNKLEEQDPRPLQPIPGLM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 669 | 669 | Amiloride-sensitive sodium channel subunit alpha | PRO_0000181261 | |||||
Regions | |||||||||
| Topological domain | 1 – 86 | 86 | Cytoplasmic By similarity | ||||||
| Transmembrane | 87 – 110 | 24 | Helical; By similarity | ||||||
| Topological domain | 111 – 543 | 433 | Extracellular By similarity | ||||||
| Transmembrane | 544 – 574 | 31 | Helical; By similarity | ||||||
| Topological domain | 575 – 669 | 95 | Cytoplasmic By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 232 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 293 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 312 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 397 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 511 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MGMARGSLTRVPGVMGEGTQ GPELSLDPDPCSPQSTPGLM KGNKLEEQDPRPLQPIPGLM in isoform 2. | VSP_007719 | |||||
| Alternative sequence | 1 | 1 | M → MSSIKGNKLEEQDPRPLQPI PGLM in isoform 6. | VSP_043667 | |||||
| Alternative sequence | 229 – 245 | 17 | CNQNK…YSSGV → ELLSLPPPDVWKLLYFG in isoform 3. | VSP_007720 | |||||
| Alternative sequence | 246 – 669 | 424 | Missing in isoform 3. | VSP_007721 | |||||
| Alternative sequence | 327 – 345 | 19 | Missing in isoform 4. | VSP_007722 | |||||
| Alternative sequence | 454 | 1 | G → GQVRSLTPVIPALWEAEAGG SRG in isoform 5. | VSP_007723 | |||||
| Natural variant | 61 | 1 | F → L in BESC2; hypoactive mutation resulting in reduction of protein expression and a significant decrease of amiloride-sensitive sodium currents. Ref.30 Corresponds to variant rs61758859 [ dbSNP | Ensembl ]. | VAR_060793 | |||||
| Natural variant | 114 | 1 | V → I in BESC2; hyperactive mutation resulting in a significant increase of amiloride-sensitive sodium currents. Ref.30 Corresponds to variant rs61759861 [ dbSNP | Ensembl ]. | VAR_060794 | |||||
| Natural variant | 181 | 1 | R → W Functional polymorphism; significant increase of amiloride-sensitive sodium currents. Ref.29 Ref.30 Corresponds to variant rs55797039 [ dbSNP | Ensembl ]. | VAR_060795 | |||||
| Natural variant | 327 | 1 | G → C in PHA1B; results in a significant reduction of channel function as compared to wild-type; significantly lowers both Li+ and Na+ ion currents. Ref.19 Ref.28 | VAR_026518 | |||||
| Natural variant | 334 | 1 | A → T Functional polymorphism; significant decrease of amiloride-sensitive sodium currents. Ref.21 Ref.30 Corresponds to variant rs11542844 [ dbSNP | Ensembl ]. | VAR_060796 | |||||
| Natural variant | 402 | 1 | P → H. Corresponds to variant rs13306616 [ dbSNP | Ensembl ]. | VAR_052035 | |||||
| Natural variant | 493 | 1 | W → R Functional polymorphism resulting in a 4-fold increase of amiloride-sensitive sodium currents; found in BESC2 patients at higher frequency than in controls; associated with an incresed risk for ischemic cerebrovascular events. Ref.25 Ref.27 Ref.30 Corresponds to variant rs5742912 [ dbSNP | Ensembl ]. | VAR_015833 | |||||
| Natural variant | 562 | 1 | S → L in PHA1B. Ref.25 | VAR_015834 | |||||
| Natural variant | 573 | 1 | V → I. Corresponds to variant rs59142484 [ dbSNP | Ensembl ]. | VAR_060797 | |||||
| Natural variant | 618 | 1 | C → F. Ref.21 Corresponds to variant rs3741913 [ dbSNP | Ensembl ]. | VAR_022142 | |||||
| Natural variant | 663 | 1 | T → A. Ref.5 Ref.10 Ref.21 Ref.24 Ref.26 Ref.27 Ref.30 Corresponds to variant rs2228576 [ dbSNP | Ensembl ]. | VAR_015835 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The lung amiloride-sensitive Na+ channel: biophysical properties, pharmacology, ontogenesis, and molecular cloning." Voilley N., Lingueglia E., Champigny G., Mattei M.-G., Waldmann R., Lazdunski M., Barbry P. Proc. Natl. Acad. Sci. U.S.A. 91:247-251(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Lung. |
| [2] | "Cloning, expression, and tissue distribution of a human amiloride-sensitive Na+ channel." McDonald F.J., Snyder P.M., McCray P.B. Jr., Welsh M.J. Am. J. Physiol. 266:L728-L734(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Kidney. |
| [3] | "Structural organisation of the gene encoding the alpha-subunit of the human amiloride-sensitive epithelial sodium channel." Ludwig M., Bolkenius U., Wickert L., Marynen P., Bidlingmaier F. Hum. Genet. 102:576-581(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Hormonal regulation and genomic organization of the human amiloride-sensitive epithelial sodium channel alpha subunit gene." Chow Y.H., Wang Y., Plumb J., O'Brodovich H., Hu J. Pediatr. Res. 46:208-214(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Upregulated expression of ENaC in human CF nasal epithelium." Bangel N., Dahlhoff C., Sobczak K., Weber W.M., Kusche-Vihrog K. J. Cyst. Fibros. 7:197-205(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ALA-663. Tissue: Nasal epithelium. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Tissue: Trachea. |
| [7] | NHLBI resequencing and genotyping service (RS&G) Submitted (DEC-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [8] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ALA-663. Tissue: Colon and Lung. |
| [11] | "5' heterogeneity in epithelial sodium channel alpha-subunit mRNA leads to distinct NH2-terminal variant proteins." Thomas C.P., Auerbach S.D., Stokes J.B., Volk K.A. Am. J. Physiol. 274:C1312-C1323(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-50, ALTERNATIVE SPLICING (ISOFORMS 1 AND 2). Tissue: Kidney. |
| [12] | "The alpha-subunit of the epithelial sodium channel is an aldosterone-induced transcript in mammalian collecting ducts, and this transcriptional response is mediated via distinct cis-elements in the 5'-flanking region of the gene." Mick V.E., Itani O.A., Loftus R.W., Husted R.F., Schmidt T.J., Thomas C.P. Mol. Endocrinol. 15:575-588(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-50 (ISOFORMS 1 AND 2), INDUCTION. Tissue: Placenta. |
| [13] | "Type I pseudohypoaldosteronism includes two clinically and genetically distinct entities with either renal or multiple target organ defects." Hanukoglu A. J. Clin. Endocrinol. Metab. 73:936-944(1991) [PubMed] [Europe PMC] [Abstract] Cited for: DEFINITION OF DIFFERENT FORMS OF PSEUDOHYPOALDOSTERONISM TYPE 1. |
| [14] | "Cloning and functional studies of splice variants of the alpha-subunit of the amiloride-sensitive Na+ channel." Tucker J.K., Tamba K., Lee Y.-J., Shen L.-L., Warnock D.G., Oh Y. Am. J. Physiol. 274:C1081-C1089(1998) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 1; 3; 4 AND 5), TISSUE SPECIFICITY. |
| [15] | "Identification of novel human WW domain-containing proteins by cloning of ligand targets." Pirozzi G., McConnell S.J., Uveges A.J., Carter J.M., Sparks A.B., Kay B.K., Fowlkes D.M. J. Biol. Chem. 272:14611-14616(1997) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH WWP1 AND WWP2. |
| [16] | "The Nedd4-like protein KIAA0439 is a potential regulator of the epithelial sodium channel." Harvey K.F., Dinudom A., Cook D.I., Kumar S. J. Biol. Chem. 276:8597-8601(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NEDD4 AND NEDD4L. |
| [17] | "Ubiquitin-protein ligase WWP2 binds to and downregulates the epithelial Na(+) channel." McDonald F.J., Western A.H., McNeil J.D., Thomas B.C., Olson D.R., Snyder P.M. Am. J. Physiol. 283:F431-F436(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NEDD4 AND WWP2. |
| [18] | "Proteolytic processing of the epithelial sodium channel gamma subunit has a dominant role in channel activation." Carattino M.D., Hughey R.P., Kleyman T.R. J. Biol. Chem. 283:25290-25295(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEOLYTIC PROCESSING. |
| [19] | "Renin-aldosterone response, urinary Na/K ratio and growth in pseudohypoaldosteronism patients with mutations in epithelial sodium channel (ENaC) subunit genes." Hanukoglu A., Edelheit O., Shriki Y., Gizewska M., Dascal N., Hanukoglu I. J. Steroid Biochem. Mol. Biol. 111:268-274(2008) [PubMed] [Europe PMC] [Abstract] Cited for: GENOTYPE-PHENOTYPE RELATIONSHIPS IN PHA1B, LONG-TERM EFFECTS OF MUTATIONS ON PHA1B, VARIANT PHA1B CYS-327, CHARACTERIZATION OF VARIANT PHA1B CYS-327. |
| [20] | "Regulation of epithelial sodium channel trafficking by proprotein convertase subtilisin/kexin type 9 (PCSK9)." Sharotri V., Collier D.M., Olson D.R., Zhou R., Snyder P.M. J. Biol. Chem. 287:19266-19274(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PCSK9. |
| [21] | "Genetic variants in the epithelial sodium channel in relation to aldosterone and potassium excretion and risk for hypertension." Ambrosius W.T., Bloem L.J., Zhou L., Rebhun J.F., Snyder P.M., Wagner M.A., Guo C., Pratt J.H. Hypertension 34:631-637(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS THR-334; PHE-618 AND ALA-663. |
| [22] | Erratum Ambrosius W.T., Bloem L.J., Zhou L., Rebhun J.F., Snyder P.M., Wagner M.A., Guo C., Pratt J.H. Hypertension 41:1E-1E(2003) |
| [23] | "Serum and glucocorticoid-regulated kinase modulates Nedd4-2-mediated inhibition of the epithelial Na+ channel." Snyder P.M., Olson D.R., Thomas B.C. J. Biol. Chem. 277:5-8(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NEDD4 AND NEDD4L. |
| [24] | "Polymorphisms of amiloride-sensitive sodium channel subunits in five sporadic cases of pseudohypoaldosteronism: do they have pathologic potential?" Arai K., Zachman K., Shibasaki T., Chrousos G.P. J. Clin. Endocrinol. Metab. 84:2434-2437(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ALA-663. |
| [25] | "Lung symptoms in pseudohypoaldosteronism type 1 are associated with deficiency of the alpha-subunit of the epithelial sodium channel." Schaedel C., Marthinsen L., Kristoffersson A.-C., Kornfalt R., Nilsson K.O., Orlenius B., Holmberg L. J. Pediatr. 135:739-745(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PHA1B LEU-562, VARIANT ARG-493. |
| [26] | "Novel mutations responsible for autosomal recessive multisystem pseudohypoaldosteronism and sequence variants in epithelial sodium channel alpha-, beta-, and gamma-subunit genes." Saxena A., Hanukoglu I., Saxena D., Thompson R.J., Gardiner R.M., Hanukoglu A. J. Clin. Endocrinol. Metab. 87:3344-3350(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ALA-663. |
| [27] | "Impact of alphaENaC polymorphisms on the risk of ischemic cerebrovascular events: a multicenter case-control study." Hsieh K., Lalouschek W., Schillinger M., Endler G., Reisinger M., Janisiw M., Lang W., Cheng S., Wagner O., Mannhalter C. Clin. Chem. 51:952-956(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ALA-663, ASSOCIATION OF VARIANT ARG-493 WITH RISK FOR ISCHEMIC CEREBROVASCULAR EVENTS. |
| [28] | "Novel mutations in epithelial sodium channel (ENaC) subunit genes and phenotypic expression of multisystem pseudohypoaldosteronism." Edelheit O., Hanukoglu I., Gizewska M., Kandemir N., Tenenbaum-Rakover Y., Yurdakoek M., Zajaczek S., Hanukoglu A. Clin. Endocrinol. (Oxf.) 62:547-553(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PHA1B CYS-327. |
| [29] | "Mutations in the beta-subunit of the epithelial Na+ channel in patients with a cystic fibrosis-like syndrome." Sheridan M.B., Fong P., Groman J.D., Conrad C., Flume P., Diaz R., Harris C., Knowles M., Cutting G.R. Hum. Mol. Genet. 14:3493-3498(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT TRP-181. |
| [30] | "Mutations in the amiloride-sensitive epithelial sodium channel in patients with cystic fibrosis-like disease." Azad A.K., Rauh R., Vermeulen F., Jaspers M., Korbmacher J., Boissier B., Bassinet L., Fichou Y., des Georges M., Stanke F., De Boeck K., Dupont L., Balascakova M., Hjelte L., Lebecque P., Radojkovic D., Castellani C., Schwartz M. Cuppens H.Hum. Mutat. 30:1093-1103(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS BESC2 LEU-61 AND ILE-114, VARIANTS TRP-181; THR-334; ARG-493 AND ALA-663, CHARACTERIZATION OF VARIANTS BESC2 LEU-61 AND ILE-114, CHARACTERIZATION OF VARIANTS TRP-181; THR-334 AND ARG-493. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X76180 mRNA. Translation: CAA53773.1. L29007 Genomic DNA. Translation: AAA21813.1. Z92978 Z92981 Genomic DNA. Translation: CAB07505.1.AF060913 AF060912 Genomic DNA. Translation: AAD28355.1.DQ402522 mRNA. Translation: ABD72218.1. AK304379 mRNA. Translation: BAG65217.1. FJ515830 Genomic DNA. Translation: ACS13721.1. AC005840 Genomic DNA. No translation available. AC006057 Genomic DNA. No translation available. CH471116 Genomic DNA. Translation: EAW88804.1. BC006526 mRNA. Translation: AAH06526.2. Different initiation. BC062613 mRNA. Translation: AAH62613.1. U81961 Genomic DNA. Translation: AAC31773.1. U81961 Genomic DNA. Translation: AAC31774.1. |
| IPI | IPI00019931. IPI00334114. IPI00334115. IPI00334116. IPI00334117. IPI00929433. |
| PIR | A49585. |
| RefSeq | NP_001029.1. NM_001038.5. NP_001153047.1. NM_001159575.1. NP_001153048.1. NM_001159576.1. |
| UniGene | Hs.591047. |
3D structure databases | |
| ProteinModelPortal | P37088. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-198663. |
| STRING | 9606.ENSP00000228916. |
Protein family/group databases | |
| TCDB | 1.A.6.1.1. epithelial Na+ channel (ENaC) family. |
PTM databases | |
| PhosphoSite | P37088. |
Polymorphism databases | |
| DMDM | 585966. |
Proteomic databases | |
| PaxDb | P37088. |
| PRIDE | P37088. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000228916; ENSP00000228916; ENSG00000111319. ENST00000360168; ENSP00000353292; ENSG00000111319. ENST00000543768; ENSP00000438739; ENSG00000111319. |
| GeneID | 6337. |
| KEGG | hsa:6337. |
| UCSC | uc001qnv.3. human. uc001qnw.3. human. |
Organism-specific databases | |
| CTD | 6337. |
| GeneCards | GC12M006456. |
| HGNC | HGNC:10599. SCNN1A. |
| HPA | HPA012743. HPA012939. |
| MIM | 264350. phenotype. 600228. gene. 613021. phenotype. |
| neXtProt | NX_P37088. |
| Orphanet | 171876. Generalized pseudohypoaldosteronism type 1. |
| PharmGKB | PA305. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG288544. |
| HOGENOM | HOG000236286. |
| HOVERGEN | HBG058435. |
| InParanoid | P37088. |
| KO | K04824. |
| OMA | WVFQMLS. |
| OrthoDB | EOG4BK53F. |
Gene expression databases | |
| ArrayExpress | P37088. |
| Bgee | P37088. |
| CleanEx | HS_SCNN1A. |
| Genevestigator | P37088. |
| GermOnline | ENSG00000111319. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004724. EnaC. IPR001873. Na+channel_ASC. IPR020903. Na+channel_ASC_CS. [Graphical view] |
| PANTHER | PTHR11690. PTHR11690. 1 hit. |
| Pfam | PF00858. ASC. 1 hit. [Graphical view] |
| PRINTS | PR01078. AMINACHANNEL. |
| TIGRFAMs | TIGR00859. ENaC. 1 hit. |
| PROSITE | PS01206. ASC. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P37088. |
| ChEMBL | CHEMBL1791. |
| ChiTaRS | SCNN1A. human. |
| DrugBank | DB00594. Amiloride. DB00384. Triamterene. |
| GenomeRNAi | 6337. |
| NextBio | 24608. |
| SOURCE | Search... |
Entry information
| Entry name | SCNNA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P37088 Secondary accession number(s): A5X2U9 Q9UM64 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
