P37088 (SCNNA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Amiloride-sensitive sodium channel subunit alpha Alternative name(s): Alpha-NaCH Epithelial Na(+) channel subunit alpha Short name=Alpha-ENaC Short name=ENaCA Nonvoltage-gated sodium channel 1 subunit alpha SCNEA | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 669 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception. |
| Enzyme regulation | Activated by WNK1, WNK2, WNK3 and WNK4 By similarity. |
| Subunit structure | Probable heterotrimer containing one alpha, one beta and one gamma subunit. A delta subunit can replace the alpha subunit. Interacts with the WW domains of NEDD4, NEDD4L, WWP1 and WWP2. Ref.13 Ref.14 Ref.15 Ref.19 |
| Subcellular location | Apical cell membrane; Multi-pass membrane protein. Note: Apical membrane of epithelial cells. |
| Tissue specificity | Highly expressed in kidney and lung. Detected at intermediate levels in pancreas and liver, and at low levels in heart and placenta. Isoform 1 and isoform 2 predominate in all tissues. Expression of isoform 3, isoform 4 and isoform 5 is very low or not detectable, except in lung and heart. Ref.12 |
| Induction | By aldosterone. Ref.10 |
| Post-translational modification | Ubiquitinated; this targets individual subunits for endocytosis and proteasome-mediated degradation By similarity. |
| Involvement in disease | Defects in SCNN1A are a cause of autosomal recessive pseudohypoaldosteronism type 1 (AR-PHA1) [MIM:264350]. PHA1 is a rare salt wasting disease resulting from target organ unresponsiveness to mineralocorticoids. There are 2 forms of PHA1: the autosomal recessive form that is severe, and the dominant form which is milder and due to defects in mineralocorticoid receptor. AR-PHA1 is characterized by an often fulminant presentation in the neonatal period with dehydration, hyponatraemia, hyperkalaemia, metabolic acidosis, failure to thrive and weight loss. Note=The degree of channel function impairment differentially affects the renin-aldosterone system and urinary Na/K ratios, resulting in distinct genotype-phenotype relationships in PHA1 patients. Loss-of-function mutations are associated with a severe clinical course and age-dependent hyperactivation of the renin-aldosterone system. This feature is not observed in patients with missense mutations that reduce but do not eliminate channel function. Markedly reduced channel activity results in impaired linear growth and delayed puberty. Ref.16 Ref.21 Ref.24 Defects in SCNN1A are a cause of bronchiectasis with or without elevated sweat chloride type 2 (BESC2) [MIM:613021]; also called cystic fibrosis-like syndrome. BESC2 is a debilitating respiratory disease characterized by chronic abnormal dilatation of the bronchi and other cystic fibrosis-like symptoms in the absence of known causes of bronchiectasis (cystic fibrosis, autoimmune diseases, ciliary dyskinesia, common variable immunodeficiency, foreign body obstruction). Clinical features include subnormal lung function, sinopulmonary infections, chronic productive cough, excessive sputum production, and elevated sweat chloride in some cases. Ref.26 |
| Sequence similarities | Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1A subfamily. [View classification] |
| Sequence caution | The sequence AAH06526.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Sensory transduction Sodium transport Taste Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Sodium |
| Molecular function | Ionic channel Sodium channel |
| PTM | Glycoprotein Ubl conjugation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | excretion Traceable author statement. Source: ProtInc response to stimulusInferred from electronic annotation. Source: UniProtKB-KW sensory perception of tasteInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | apical plasma membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | WW domain binding Inferred from physical interaction. Source: BHF-UCL |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P37088-1) Also known as: Alpha ENAC1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P37088-2) Also known as: Alpha ENAC2; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGMARGSLTRVPGVMGEGTQGPELSLDPDPCSPQSTPGLMKGNKLEEQDPRPLQPIPGLM | ||||||
| Isoform 3 (identifier: P37088-3) Also known as: Alpha ENACx; The sequence of this isoform differs from the canonical sequence as follows: 229-245: CNQNKSDCFYQTYSSGV → ELLSLPPPDVWKLLYFG 246-669: Missing. | ||||||
| Note: Does not give rise to amiloride-sensitive ion current. | ||||||
| Isoform 4 (identifier: P37088-4) Also known as: Alpha ENAC-19; The sequence of this isoform differs from the canonical sequence as follows: 327-345: Missing. | ||||||
| Note: Amiloride-sensitive ion current is nearly abolished. | ||||||
| Isoform 5 (identifier: P37088-5) Also known as: Alpha ENAC+22; The sequence of this isoform differs from the canonical sequence as follows: 454-454: G → GQVRSLTPVIPALWEAEAGGSRG | ||||||
| Note: Does not give rise to amiloride-sensitive ion current. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 669 | 669 | Amiloride-sensitive sodium channel subunit alpha | PRO_0000181261 | |||||
Regions | |||||||||
| Topological domain | 1 – 86 | 86 | Cytoplasmic By similarity | ||||||
| Transmembrane | 87 – 110 | 24 | Helical; By similarity | ||||||
| Topological domain | 111 – 543 | 433 | Extracellular By similarity | ||||||
| Transmembrane | 544 – 574 | 31 | Helical; By similarity | ||||||
| Topological domain | 575 – 669 | 95 | Cytoplasmic By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 232 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 293 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 312 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 397 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 511 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MGMARGSLTRVPGVMGEGTQ GPELSLDPDPCSPQSTPGLM KGNKLEEQDPRPLQPIPGLM in isoform 2. | VSP_007719 | |||||
| Alternative sequence | 229 – 245 | 17 | CNQNK…YSSGV → ELLSLPPPDVWKLLYFG in isoform 3. | VSP_007720 | |||||
| Alternative sequence | 246 – 669 | 424 | Missing in isoform 3. | VSP_007721 | |||||
| Alternative sequence | 327 – 345 | 19 | Missing in isoform 4. | VSP_007722 | |||||
| Alternative sequence | 454 | 1 | G → GQVRSLTPVIPALWEAEAGG SRG in isoform 5. | VSP_007723 | |||||
| Natural variant | 61 | 1 | F → L in BESC2; hypoactive mutation resulting in reduction of protein expression and a significant decrease of amiloride-sensitive sodium currents. Ref.26 Corresponds to variant rs61758859 [ dbSNP | Ensembl ]. | VAR_060793 | |||||
| Natural variant | 114 | 1 | V → I in BESC2; hyperactive mutation resulting in a significant increase of amiloride-sensitive sodium currents. Ref.26 Corresponds to variant rs61759861 [ dbSNP | Ensembl ]. | VAR_060794 | |||||
| Natural variant | 181 | 1 | R → W Functional polymorphism; significant increase of amiloride-sensitive sodium currents. Ref.25 Ref.26 Corresponds to variant rs55797039 [ dbSNP | Ensembl ]. | VAR_060795 | |||||
| Natural variant | 327 | 1 | G → C in AR-PHA1; results in a significant reduction of channel function as compared to wild-type; significantly lowers both Li+ and Na+ ion currents. Ref.16 Ref.24 | VAR_026518 | |||||
| Natural variant | 334 | 1 | A → T Functional polymorphism; significant decrease of amiloride-sensitive sodium currents. Ref.17 Ref.26 Corresponds to variant rs11542844 [ dbSNP | Ensembl ]. | VAR_060796 | |||||
| Natural variant | 402 | 1 | P → H. Corresponds to variant rs13306616 [ dbSNP | Ensembl ]. | VAR_052035 | |||||
| Natural variant | 493 | 1 | W → R Functional polymorphism resulting in a 4-fold increase of amiloride-sensitive sodium currents; found in BESC2 patients at higher frequency than in controls; associated with an incresed risk for ischemic cerebrovascular events. Ref.21 Ref.23 Ref.26 Corresponds to variant rs5742912 [ dbSNP | Ensembl ]. | VAR_015833 | |||||
| Natural variant | 562 | 1 | S → L in AR-PHA1. Ref.21 | VAR_015834 | |||||
| Natural variant | 573 | 1 | V → I. Corresponds to variant rs59142484 [ dbSNP | Ensembl ]. | VAR_060797 | |||||
| Natural variant | 618 | 1 | C → F. Ref.17 Corresponds to variant rs3741913 [ dbSNP | Ensembl ]. | VAR_022142 | |||||
| Natural variant | 663 | 1 | T → A. Ref.5 Ref.8 Ref.17 Ref.20 Ref.22 Ref.23 Ref.26 Corresponds to variant rs2228576 [ dbSNP | Ensembl ]. | VAR_015835 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The lung amiloride-sensitive Na+ channel: biophysical properties, pharmacology, ontogenesis, and molecular cloning." Voilley N., Lingueglia E., Champigny G., Mattei M.-G., Waldmann R., Lazdunski M., Barbry P. Proc. Natl. Acad. Sci. U.S.A. 91:247-251(1994) [PubMed: 8278374] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Lung. |
| [2] | "Cloning, expression, and tissue distribution of a human amiloride-sensitive Na+ channel." McDonald F.J., Snyder P.M., McCray P.B. Jr., Welsh M.J. Am. J. Physiol. 266:L728-L734(1994) [PubMed: 8023962] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Kidney. |
| [3] | "Structural organisation of the gene encoding the alpha-subunit of the human amiloride-sensitive epithelial sodium channel." Ludwig M., Bolkenius U., Wickert L., Marynen P., Bidlingmaier F. Hum. Genet. 102:576-581(1998) [PubMed: 9654208] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Hormonal regulation and genomic organization of the human amiloride-sensitive epithelial sodium channel alpha subunit gene." Chow Y.H., Wang Y., Plumb J., O'Brodovich H., Hu J. Pediatr. Res. 46:208-214(1999) [PubMed: 10447117] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Upregulated expression of ENaC in human CF nasal epithelium." Bangel N., Dahlhoff C., Sobczak K., Weber W.M., Kusche-Vihrog K. J. Cyst. Fibros. 7:197-205(2008) [PubMed: 17766193] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ALA-663. Tissue: Nasal epithelium. |
| [6] | NHLBI resequencing and genotyping service (RS&G) Submitted (DEC-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ALA-663. Tissue: Colon and Lung. |
| [9] | "5' heterogeneity in epithelial sodium channel alpha-subunit mRNA leads to distinct NH2-terminal variant proteins." Thomas C.P., Auerbach S.D., Stokes J.B., Volk K.A. Am. J. Physiol. 274:C1312-C1323(1998) [PubMed: 9612219] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-50, ALTERNATIVE SPLICING (ISOFORMS 1 AND 2). Tissue: Kidney. |
| [10] | "The alpha-subunit of the epithelial sodium channel is an aldosterone-induced transcript in mammalian collecting ducts, and this transcriptional response is mediated via distinct cis-elements in the 5'-flanking region of the gene." Mick V.E., Itani O.A., Loftus R.W., Husted R.F., Schmidt T.J., Thomas C.P. Mol. Endocrinol. 15:575-588(2001) [PubMed: 11266509] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-50 (ISOFORMS 1 AND 2), INDUCTION. Tissue: Placenta. |
| [11] | "Type I pseudohypoaldosteronism includes two clinically and genetically distinct entities with either renal or multiple target organ defects." Hanukoglu A. J. Clin. Endocrinol. Metab. 73:936-944(1991) [PubMed: 1939532] [Abstract] Cited for: DEFINITION OF DIFFERENT FORMS OF PSEUDOHYPOALDOSTERONISM TYPE 1. |
| [12] | "Cloning and functional studies of splice variants of the alpha-subunit of the amiloride-sensitive Na+ channel." Tucker J.K., Tamba K., Lee Y.-J., Shen L.-L., Warnock D.G., Oh Y. Am. J. Physiol. 274:C1081-C1089(1998) [PubMed: 9575806] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 1; 3; 4 AND 5), TISSUE SPECIFICITY. |
| [13] | "Identification of novel human WW domain-containing proteins by cloning of ligand targets." Pirozzi G., McConnell S.J., Uveges A.J., Carter J.M., Sparks A.B., Kay B.K., Fowlkes D.M. J. Biol. Chem. 272:14611-14616(1997) [PubMed: 9169421] [Abstract] Cited for: INTERACTION WITH WWP1 AND WWP2. |
| [14] | "The Nedd4-like protein KIAA0439 is a potential regulator of the epithelial sodium channel." Harvey K.F., Dinudom A., Cook D.I., Kumar S. J. Biol. Chem. 276:8597-8601(2001) [PubMed: 11244092] [Abstract] Cited for: INTERACTION WITH NEDD4 AND NEDD4L. |
| [15] | "Ubiquitin-protein ligase WWP2 binds to and downregulates the epithelial Na(+) channel." McDonald F.J., Western A.H., McNeil J.D., Thomas B.C., Olson D.R., Snyder P.M. Am. J. Physiol. 283:F431-F436(2002) [PubMed: 12167593] [Abstract] Cited for: INTERACTION WITH NEDD4 AND WWP2. |
| [16] | "Renin-aldosterone response, urinary Na/K ratio and growth in pseudohypoaldosteronism patients with mutations in epithelial sodium channel (ENaC) subunit genes." Hanukoglu A., Edelheit O., Shriki Y., Gizewska M., Dascal N., Hanukoglu I. J. Steroid Biochem. Mol. Biol. 111:268-274(2008) [PubMed: 18634878] [Abstract] Cited for: GENOTYPE-PHENOTYPE RELATIONSHIPS IN AR-PHA1, LONG-TERM EFFECTS OF MUTATIONS ON AR-PHA1, VARIANT AR-PHA1 CYS-327, CHARACTERIZATION OF VARIANT AR-PHA1 CYS-327. |
| [17] | "Genetic variants in the epithelial sodium channel in relation to aldosterone and potassium excretion and risk for hypertension." Ambrosius W.T., Bloem L.J., Zhou L., Rebhun J.F., Snyder P.M., Wagner M.A., Guo C., Pratt J.H. Hypertension 34:631-637(1999) [PubMed: 10523338] [Abstract] Cited for: VARIANTS THR-334; PHE-618 AND ALA-663. |
| [18] | Erratum Ambrosius W.T., Bloem L.J., Zhou L., Rebhun J.F., Snyder P.M., Wagner M.A., Guo C., Pratt J.H. Hypertension 41:1E-1E(2003) |
| [19] | "Serum and glucocorticoid-regulated kinase modulates Nedd4-2-mediated inhibition of the epithelial Na+ channel." Snyder P.M., Olson D.R., Thomas B.C. J. Biol. Chem. 277:5-8(2002) [PubMed: 11696533] [Abstract] Cited for: INTERACTION WITH NEDD4 AND NEDD4L. |
| [20] | "Polymorphisms of amiloride-sensitive sodium channel subunits in five sporadic cases of pseudohypoaldosteronism: do they have pathologic potential?" Arai K., Zachman K., Shibasaki T., Chrousos G.P. J. Clin. Endocrinol. Metab. 84:2434-2437(1999) [PubMed: 10404817] [Abstract] Cited for: VARIANT ALA-663. |
| [21] | "Lung symptoms in pseudohypoaldosteronism type 1 are associated with deficiency of the alpha-subunit of the epithelial sodium channel." Schaedel C., Marthinsen L., Kristoffersson A.-C., Kornfalt R., Nilsson K.O., Orlenius B., Holmberg L. J. Pediatr. 135:739-745(1999) [PubMed: 10586178] [Abstract] Cited for: VARIANT AR-PHA1 LEU-562, VARIANT ARG-493. |
| [22] | "Novel mutations responsible for autosomal recessive multisystem pseudohypoaldosteronism and sequence variants in epithelial sodium channel alpha-, beta-, and gamma-subunit genes." Saxena A., Hanukoglu I., Saxena D., Thompson R.J., Gardiner R.M., Hanukoglu A. J. Clin. Endocrinol. Metab. 87:3344-3350(2002) [PubMed: 12107247] [Abstract] Cited for: VARIANT ALA-663. |
| [23] | "Impact of alphaENaC polymorphisms on the risk of ischemic cerebrovascular events: a multicenter case-control study." Hsieh K., Lalouschek W., Schillinger M., Endler G., Reisinger M., Janisiw M., Lang W., Cheng S., Wagner O., Mannhalter C. Clin. Chem. 51:952-956(2005) [PubMed: 15734793] [Abstract] Cited for: VARIANT ALA-663, ASSOCIATION OF VARIANT ARG-493 WITH RISK FOR ISCHEMIC CEREBROVASCULAR EVENTS. |
| [24] | "Novel mutations in epithelial sodium channel (ENaC) subunit genes and phenotypic expression of multisystem pseudohypoaldosteronism." Edelheit O., Hanukoglu I., Gizewska M., Kandemir N., Tenenbaum-Rakover Y., Yurdakoek M., Zajaczek S., Hanukoglu A. Clin. Endocrinol. (Oxf.) 62:547-553(2005) [PubMed: 15853823] [Abstract] Cited for: VARIANT AR-PHA1 CYS-327. |
| [25] | "Mutations in the beta-subunit of the epithelial Na+ channel in patients with a cystic fibrosis-like syndrome." Sheridan M.B., Fong P., Groman J.D., Conrad C., Flume P., Diaz R., Harris C., Knowles M., Cutting G.R. Hum. Mol. Genet. 14:3493-3498(2005) [PubMed: 16207733] [Abstract] Cited for: VARIANT TRP-181. |
| [26] | "Mutations in the amiloride-sensitive epithelial sodium channel in patients with cystic fibrosis-like disease." Azad A.K., Rauh R., Vermeulen F., Jaspers M., Korbmacher J., Boissier B., Bassinet L., Fichou Y., des Georges M., Stanke F., De Boeck K., Dupont L., Balascakova M., Hjelte L., Lebecque P., Radojkovic D., Castellani C., Schwartz M. Cuppens H.Hum. Mutat. 30:1093-1103(2009) [PubMed: 19462466] [Abstract] Cited for: VARIANTS BESC2 LEU-61 AND ILE-114, VARIANTS TRP-181; THR-334; ARG-493 AND ALA-663, CHARACTERIZATION OF VARIANTS BESC2 LEU-61 AND ILE-114, CHARACTERIZATION OF VARIANTS TRP-181; THR-334 AND ARG-493. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X76180 mRNA. Translation: CAA53773.1. L29007 Genomic DNA. Translation: AAA21813.1. Z92978 Z92981 Genomic DNA. Translation: CAB07505.1.AF060913 AF060912 Genomic DNA. Translation: AAD28355.1.DQ402522 mRNA. Translation: ABD72218.1. FJ515830 Genomic DNA. Translation: ACS13721.1. CH471116 Genomic DNA. Translation: EAW88804.1. BC006526 mRNA. Translation: AAH06526.2. Different initiation. BC062613 mRNA. Translation: AAH62613.1. U81961 Genomic DNA. Translation: AAC31773.1. U81961 Genomic DNA. Translation: AAC31774.1. |
| IPI | IPI00019931. IPI00334114. IPI00334115. IPI00334116. IPI00334117. |
| PIR | A49585. |
| RefSeq | NP_001029.1. NM_001038.5. NP_001153047.1. NM_001159575.1. NP_001153048.1. NM_001159576.1. |
| UniGene | Hs.591047. |
3D structure databases | |
| ProteinModelPortal | P37088. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-198663. |
| STRING | P37088. |
Protein family/group databases | |
| TCDB | 1.A.6.1.1. epithelial Na+ channel (ENaC) family. |
PTM databases | |
| PhosphoSite | P37088. |
Polymorphism databases | |
| DMDM | 585966. |
Proteomic databases | |
| PRIDE | P37088. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000228916; ENSP00000228916; ENSG00000111319. ENST00000360168; ENSP00000353292; ENSG00000111319. ENST00000396966; ENSP00000380166; ENSG00000111319. |
| GeneID | 6337. |
| KEGG | hsa:6337. |
| UCSC | uc001qnw.1. human. |
Organism-specific databases | |
| CTD | 6337. |
| GeneCards | GC12M006456. |
| H-InvDB | HIX0201834. |
| HGNC | HGNC:10599. SCNN1A. |
| HPA | HPA012743. HPA012939. |
| MIM | 264350. phenotype. 600228. gene. 613021. phenotype. |
| neXtProt | NX_P37088. |
| Orphanet | 171876. Generalized pseudohypoaldosteronism type 1. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG19108. |
| GeneTree | ENSGT00550000074208. |
| HOVERGEN | HBG058435. |
| InParanoid | P37088. |
| OMA | LLFGEYF. |
| OrthoDB | EOG4BK53F. |
Gene expression databases | |
| ArrayExpress | P37088. |
| Bgee | P37088. |
| CleanEx | HS_SCNN1A. |
| Genevestigator | P37088. |
| GermOnline | ENSG00000111319. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004724. EnaC. IPR001873. Na+channel_ASC. IPR020903. Na+channel_ASC_CS. [Graphical view] |
| KO | K04824. |
| PANTHER | PTHR11690. Na+channel_ASC. 1 hit. |
| Pfam | PF00858. ASC. 1 hit. [Graphical view] |
| PRINTS | PR01078. AMINACHANNEL. |
| TIGRFAMs | TIGR00859. ENaC. 1 hit. |
| PROSITE | PS01206. ASC. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00594. Amiloride. DB00384. Triamterene. |
| NextBio | 24608. |
| SOURCE | Search... |
Entry information
| Entry name | SCNNA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P37088 Secondary accession number(s): A5X2U9 Q9UM64 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with